BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120784.seq (641 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0757 + 24267599-24268882 29 3.1 03_02_1023 + 13265179-13265330,13265526-13265637,13265752-132660... 28 5.5 10_07_0161 - 13674631-13675433,13675793-13675862 28 7.2 03_02_0870 + 11964135-11964224,11965013-11965175,11965262-119653... 28 7.2 05_06_0014 + 24854462-24854570,24854958-24855065,24855240-248554... 27 9.6 >06_03_0757 + 24267599-24268882 Length = 427 Score = 29.1 bits (62), Expect = 3.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 143 NWRSANTWLCSAPWK*PSRCWK 208 +WR A W+C PW + W+ Sbjct: 348 SWRPAGPWVCFNPWPAQQQAWR 369 >03_02_1023 + 13265179-13265330,13265526-13265637,13265752-13266048, 13266361-13266623,13267637-13267847,13268420-13268590, 13268671-13268748,13269275-13269520,13269763-13271868, 13272122-13273904,13274113-13274216,13274752-13275108, 13275210-13275328,13276175-13276436,13276669-13276893, 13277075-13277214,13278087-13278159,13278431-13278532, 13278647-13279018,13279183-13279230,13279516-13279900, 13280440-13280558 Length = 2574 Score = 28.3 bits (60), Expect = 5.5 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +3 Query: 411 RPSIVKMLSREFDTEALVNFENDNCNVRIAKTLAPLSAKTRRAIDYESNKQPDYDMDLS 587 R S+VK L +E LVN N V +A A R ++ E NK P + M +S Sbjct: 2084 RASLVKCLKKE-----LVNVRNGRKEVSSMLRVAMHKAAQARLMEKEKNKSPSFAMRVS 2137 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 Query: 143 NWRSANTWLCSAPWK*PSRCWK 208 +WR A W+C PW W+ Sbjct: 229 SWRPAGPWVCFNPWPAQQLAWR 250 >03_02_0870 + 11964135-11964224,11965013-11965175,11965262-11965380, 11965971-11966083,11966179-11966234,11966320-11966417, 11966588-11966725,11966820-11967125,11967208-11967471, 11967587-11967754,11967838-11968056,11968115-11968158, 11968761-11968830,11968949-11969110,11969672-11969779, 11969873-11969910,11970121-11970265,11970800-11970926, 11971037-11971230,11971529-11971659,11972014-11972089, 11972218-11972328,11972465-11972647,11973264-11973407, 11973946-11973969,11974555-11974728,11974808-11975155, 11975232-11975561,11975776-11975961,11976052-11977026, 11977145-11977399 Length = 1852 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 37 TEIVNSDEKIQKTYELAEFDLKNLSSLESYETLKIKLALSKYMAMLSTLEMTQPLLE 207 TE+ S+++ K E+ E D+ + S + YET ++ + SK LS L +P + Sbjct: 84 TELQLSNDRQSKPDEVTEDDMPSTSGRQLYET-EVPASSSKKHCSLSPLPAYEPAFD 139 >05_06_0014 + 24854462-24854570,24854958-24855065,24855240-24855432, 24855892-24856150,24856236-24856292,24856370-24856417, 24856725-24856811,24856885-24856942,24857084-24857151, 24857279-24857374,24857483-24857539,24857906-24857952, 24858184-24858210,24858312-24858504 Length = 468 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 273 HNRFHPLVTNFTNKMEFVVTETNDTSIPG 359 H FH + + TNK+E V++ T + I G Sbjct: 427 HRLFHHPIDDCTNKIEHVISRTEQSFISG 455 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,311,539 Number of Sequences: 37544 Number of extensions: 316879 Number of successful extensions: 801 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -