BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120784.seq (641 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 26 0.88 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 1.5 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 24 3.6 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.2 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 26.2 bits (55), Expect = 0.88 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +3 Query: 348 SIPGEPILFTENEGVLLCSVDRPSI---VKMLSREFDTEALVNFEND 479 S P EPI+ + + L ++RP + + ++ + A+ FEND Sbjct: 41 SHPEEPIVVEKENNITLIGINRPKVRNAIDSITGRKLSAAIAEFEND 87 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.4 bits (53), Expect = 1.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 129 NSEN*IGAQQIHGYAQHPGNDPAAVGNI*KQSRHSANCRR 248 NS N + Q H QH + P+AV N +RH++ RR Sbjct: 820 NSTNSAYSMQSHQQQQH--HQPSAVSNSNGLARHNSKSRR 857 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 24.2 bits (50), Expect = 3.6 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 391 CCCAPSTDRL 420 CCC PS++RL Sbjct: 67 CCCVPSSERL 76 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 6.2 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 115 NCLDFLNQIRPIRRFFGSFHRCLQFR 38 NC++F + +PIRR+ HR +Q++ Sbjct: 1144 NCIEFALKAKPIRRYIPK-HR-IQYK 1167 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,766 Number of Sequences: 2352 Number of extensions: 12398 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -