BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120783.seq (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 25 2.0 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 24 4.7 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 25.0 bits (52), Expect = 2.0 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +1 Query: 55 ESIRWQILNGDEIEVSPEHRSLAWRELIINVANNTPLDNTFRTMF 189 ES+ W IL + IEVS E L + A P D T F Sbjct: 207 ESVTW-ILFKEPIEVSHEQLELFREMRCYDAAEECPCDETLNKQF 250 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 74 ICHRIDSHILTTTAIWR 24 ICH I + T AIWR Sbjct: 140 ICHTISIWLTVTLAIWR 156 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,259 Number of Sequences: 2352 Number of extensions: 14240 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -