BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120782.seq (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0644 + 18337757-18337947,18339113-18339344 29 4.1 11_01_0544 + 4306436-4306762 28 5.5 >04_03_0644 + 18337757-18337947,18339113-18339344 Length = 140 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 508 NRRCWNSISKKIST-TETFQRLRNKNLTTLN 597 NR I + + T TE FQR+ N NLTT+N Sbjct: 29 NRDMTVVIERMVQTSTERFQRMLNANLTTIN 59 >11_01_0544 + 4306436-4306762 Length = 108 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +1 Query: 199 VASSPQLRLLYKNAYSA---VSAATIVFCAIWCK 291 VASSPQ + Y N YS VSA CAI C+ Sbjct: 43 VASSPQYQPSYGNTYSTCFEVSACDDTGCAIRCR 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,807,329 Number of Sequences: 37544 Number of extensions: 205387 Number of successful extensions: 532 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -