BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120779.seq (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 25 1.6 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.6 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 4.8 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.3 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 25.4 bits (53), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 354 IAAVVFSTLAFIHNRFH 404 + A+V S LA+IH R+H Sbjct: 9 VLAIVLSCLAWIHRRYH 25 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 226 SSLESYETLKLNWRSANTWL 285 S+ + LK +WRS++TW+ Sbjct: 2756 SANNCWNPLKWDWRSSSTWI 2775 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 4.8 Identities = 7/30 (23%), Positives = 21/30 (70%) Frame = +1 Query: 178 KIQKTYELAEFDLKNLSSLESYETLKLNWR 267 +++KT E + F +++ + + +E++K +W+ Sbjct: 467 EMEKTIEASRFVAQHVRNKDKFESVKEDWK 496 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 232 NCLDFLNQIRPIRRFFGSFHRCLQFR 155 NC++F + +PIRR+ HR +Q++ Sbjct: 1144 NCIEFALKAKPIRRYIPK-HR-IQYK 1167 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +1 Query: 226 SSLESYETLKLNWRSANTWL 285 ++ +S+ L+ NW+S + WL Sbjct: 2746 AAAQSWNPLEWNWKSKSLWL 2765 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 688,950 Number of Sequences: 2352 Number of extensions: 13725 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -