BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120778.seq (638 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 27 0.100 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.7 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 27.5 bits (58), Expect = 0.100 Identities = 18/77 (23%), Positives = 32/77 (41%) Frame = -3 Query: 255 PSRKNIEKMFFTLCMLSVLLA*FSKLLFMETIHLLNSLKKVRPLPSTIKLWLKYFENKKH 76 P ++ E+ FT L +L F+K + + K+ S +++W K K Sbjct: 124 PRKQRRERTTFTRAQLDLLEGLFAKTRYPDIFMREEVAVKINLPESRVQVWFKNRRAKCR 183 Query: 75 NESISSRNNCASKHTFS 25 + +N AS+ T S Sbjct: 184 QQLQQQQNKSASRTTTS 200 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = -1 Query: 524 VFVIGRSNTYNMRGMPNMGLKKMSQPFCKPSSRVLSEDAKYLH 396 VF I + T N+R + + + ++ P +S D YL+ Sbjct: 457 VFAIREAATLNLRKLVDQFGAEWAETTIIPKVLAMSRDQNYLY 499 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 165 TIHLLNSLKKVRPLPSTIKL 106 + H L SLKKV +TI++ Sbjct: 61 SFHFLRSLKKVHLQDNTIEM 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,180 Number of Sequences: 336 Number of extensions: 3582 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -