BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120764.seq (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 25 2.3 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 2.3 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.3 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.0 AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 24 4.0 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 24 4.0 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 24 4.0 AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical prote... 24 4.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 4.0 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 5.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 5.3 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 5.3 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 23 7.0 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 9.2 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 9.2 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.0 bits (52), Expect = 2.3 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 154 HSKDSKEPANEDLTGLSGPSPV-PSNPISIAGAPKKVMQTSLQKQLKWPTVLSLQRTLIS 330 HS + P ED +S P+PV P ++G +++ + ++ L + L+ L + Sbjct: 337 HSSFKQSPKPEDEFKVSSPAPVHPLAGHPLSGIKQELPELPVRHSLSSELMQPLKMPLYA 396 Query: 331 DQAQTS 348 D+ S Sbjct: 397 DEMSAS 402 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 181 NEDLTGLSGPSPVPSNPISIAGA 249 N ++ +S P P+ SNP S GA Sbjct: 211 NSPMSSVSSPGPISSNPQSPYGA 233 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 106 PAVKAGGMRITQHKTPHSKDSK-EPANEDLTGLSGP 210 P K +H ++K K EP N+ L GL GP Sbjct: 207 PGTKGEKGEPARHPENYNKGQKGEPGNDGLEGLPGP 242 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 109 AVKAGGMRITQHKTPHSKDSKEP 177 A ++G +R H PHS+DS EP Sbjct: 828 ATRSGLLRWIDH-LPHSEDSSEP 849 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 424 GNHKXANI-KLCININTNHTNTYWYL 498 G+H +++ KLC NT T WY+ Sbjct: 38 GSHAKSSVHKLCHARNTTQPRTRWYI 63 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 203 LGHLPFRPIRSPLPELQ 253 LG PFRPI P PE + Sbjct: 117 LGVPPFRPIPKPTPEAE 133 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 424 GNHKXANI-KLCININTNHTNTYWYL 498 G+H +++ KLC NT T WY+ Sbjct: 38 GSHAKSSVHKLCHAKNTTRPRTRWYI 63 >AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical protein protein. Length = 89 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 424 GNHKXANI-KLCININTNHTNTYWYL 498 G+H +++ KLC NT T WY+ Sbjct: 38 GSHAKSSVHKLCHAKNTTRPRTRWYI 63 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 203 LGHLPFRPIRSPLPELQ 253 LG PFRPI P PE + Sbjct: 122 LGVPPFRPIPKPTPEAE 138 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.8 bits (49), Expect = 5.3 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 109 AVKAGGMRITQHKTPHSKDSKEPANEDLTGLSGPSPVPSNPISIAGAPKKVMQT 270 AV A G+R+ QH + KD ++ G S + P + A ++QT Sbjct: 19 AVAADGVRVQQHTSRRFKDESFGHDQTPAGSWWSSHLTEPPSNFYQATHGLLQT 72 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.8 bits (49), Expect = 5.3 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = +1 Query: 109 AVKAGGMRITQHKTPHSKDSKEPANEDLTGLSGPSPVPSNPISIAGAPKKVMQT 270 AV A G+R+ QH + KD ++ G S + P + A ++QT Sbjct: 19 AVAADGVRVQQHTSRRFKDESFGHDQTPAGSWWSSHLTEPPSNFYQATHGLLQT 72 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 5.3 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -2 Query: 368 FLLSGLLDVWAWSEINVRWRLRTVGHLSCFWSEVCITFFGAPAMEIGLDGTGD 210 FLL W + + R+R + C + FG P +E+ + GT + Sbjct: 35 FLLQIQTIAGLWGDRSQRYRFYLIFSYFCAMVVLPKVLFGYPDLEVAVRGTAE 87 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 206 PERPVKSSLAGSLLSFE*GVL 144 P+ PVK + S L FE GVL Sbjct: 87 PKDPVKQARVNSALHFESGVL 107 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 181 NEDLTGLSGPSPVPSNPISIAGAPK 255 ++DL G P P P+ P + AP+ Sbjct: 152 SQDLFGDMMPQPQPARPYRVRRAPR 176 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 76 PRLTTLLFDNFEFNLFMISG 17 P+LTT L D+ FN+ + +G Sbjct: 342 PKLTTKLADSDGFNVLLFTG 361 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,622 Number of Sequences: 2352 Number of extensions: 13377 Number of successful extensions: 35 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -