BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120759.seq (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma m... 30 1.3 At3g57330.1 68416.m06381 calcium-transporting ATPase, plasma mem... 29 2.2 At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb... 29 3.8 At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb... 29 3.8 At2g38770.1 68415.m04760 expressed protein 28 6.7 At1g16400.1 68414.m01961 cytochrome P450 family protein similar ... 28 6.7 At3g58760.1 68416.m06549 ankyrin protein kinase, putative simila... 27 8.8 >At2g41560.1 68415.m05136 calcium-transporting ATPase 4, plasma membrane-type / Ca2+-ATPase, isoform 4 (ACA4) identical to SP|O22218 Calcium-transporting ATPase 4, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 4) {Arabidopsis thaliana} Length = 1030 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 206 VVLMVCNMSTAAICVCAEGFAGGXXXXXXRVCDMLLPVSISSIS 75 ++LMVC + + + V EGF G + +LL V +++IS Sbjct: 172 IILMVCAVVSIGVGVATEGFPRGMYDGTGILLSILLVVMVTAIS 215 >At3g57330.1 68416.m06381 calcium-transporting ATPase, plasma membrane-type, putative / Ca2+-ATPase, putative (ACA11) identical to SP|Q9M2L4|ACAB_ARATH Potential calcium-transporting ATPase 11, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 11) {Arabidopsis thaliana}; strong similarity to calmodulin-stimulated calcium-ATPase [Brassica oleracea] GI:1805654 Length = 1025 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 206 VVLMVCNMSTAAICVCAEGFAGGXXXXXXRVCDMLLPVSISSIS 75 ++LMVC + + + V EGF G + ++L V +++IS Sbjct: 172 IILMVCAVVSIGVGVATEGFPKGMYDGTGILLSIILVVMVTAIS 215 >At1g16410.2 68414.m01962 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 423 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/84 (23%), Positives = 41/84 (48%) Frame = +3 Query: 246 YAQKTESLKILSTQSVGARNLLEPMQANETKIKLNRIETVNVLDFLGSVYDNTIQVIVTE 425 Y ++ +K + T + + L+ ++A T IE N++ ++ S+Y + V V E Sbjct: 136 YGEQFMKMKRVITTEIMSVKTLKMLEAART------IEADNLIAYVHSMYQRSETVDVRE 189 Query: 426 *VCVVGHDERYRVVFGNKQIAVKN 497 V G+ R++FG + + +N Sbjct: 190 LSRVYGYAVTMRMLFGRRHVTKEN 213 >At1g16410.1 68414.m01963 cytochrome P450, putative similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family Length = 538 Score = 28.7 bits (61), Expect = 3.8 Identities = 20/84 (23%), Positives = 41/84 (48%) Frame = +3 Query: 246 YAQKTESLKILSTQSVGARNLLEPMQANETKIKLNRIETVNVLDFLGSVYDNTIQVIVTE 425 Y ++ +K + T + + L+ ++A T IE N++ ++ S+Y + V V E Sbjct: 136 YGEQFMKMKRVITTEIMSVKTLKMLEAART------IEADNLIAYVHSMYQRSETVDVRE 189 Query: 426 *VCVVGHDERYRVVFGNKQIAVKN 497 V G+ R++FG + + +N Sbjct: 190 LSRVYGYAVTMRMLFGRRHVTKEN 213 >At2g38770.1 68415.m04760 expressed protein Length = 1509 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -2 Query: 521 YRQLLGSSIFNRNLFISKYNAIALIVTDDAHLLCNYHLDRVVVNAPQKV*HVDRFDSIQL 342 Y +LLG N+ ++ YN L++ D + C + + P KV VD+F Q Sbjct: 1274 YMRLLGYPA-NKISILTTYNGQKLLIRDVINRRC---VPYPFIGPPSKVTTVDKFQGQQN 1329 Query: 341 NFGLVGLHR 315 +F L+ L R Sbjct: 1330 DFILLSLVR 1338 >At1g16400.1 68414.m01961 cytochrome P450 family protein similar to gb|AF069494 cytochrome P450 from Sinapis alba and is a member of the PF|00067 Cytochrome P450 family; identical to cytochrome P450 CYP79F2 (CYP79F2) GI:10946207 Length = 537 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 354 IETVNVLDFLGSVYDNTIQVIVTE*VCVVGHDERYRVVFGNKQIAVKN 497 IE N++ ++ S+Y + V V E V G+ R++FG + + +N Sbjct: 165 IEADNLIAYIHSMYQRSETVDVRELSRVYGYAVTMRMLFGRRHVTKEN 212 >At3g58760.1 68416.m06549 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674 Length = 471 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 345 LNRIETVNVLDFLGSVYDNTIQVIVTE 425 L +I NV+ FLG+V +T +IVTE Sbjct: 213 LQKIRHPNVVQFLGAVTQSTPMMIVTE 239 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,047,628 Number of Sequences: 28952 Number of extensions: 270989 Number of successful extensions: 694 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -