BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120756.seq (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 5.5 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 7.3 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = +1 Query: 7 RLITEFVLRVEFYL*RTIKK*CHLFCNMISYNMTHLFF 120 R++ F++ + T H+ N Y TH+FF Sbjct: 39 RILKYFIIAIYVLTILTSSVTLHVCFNSYMYAFTHIFF 76 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 7.3 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +2 Query: 38 NSTCNAQSRNDVICFAI*YHTI*LICFSKSNLIYGQNS 151 N C +N C A L+ SKS YG+ S Sbjct: 45 NGECVINKKNRTACKACRLRKCLLVGMSKSGSRYGRRS 82 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,510 Number of Sequences: 336 Number of extensions: 2754 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -