BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120756.seq (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0457 + 18076911-18077272,18077356-18077475,18077554-180777... 32 0.50 09_02_0539 - 10408398-10409552 29 4.7 >10_08_0457 + 18076911-18077272,18077356-18077475,18077554-18077782, 18077993-18078652,18079224-18079425,18079521-18079611, 18079780-18079837 Length = 573 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -1 Query: 123 FEKQMSHIV*YHIAKQMTSFLDCALQVEFYS*NEFGY 13 F + MS I H+ K+MT+F + A QVE + EF Y Sbjct: 129 FNRMMSSIRLLHLRKKMTTFKNIATQVEILTKREFLY 165 >09_02_0539 - 10408398-10409552 Length = 384 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = -3 Query: 160 FTS-RI-LPVNQVRF*KTNESYCMISYCKTNDI 68 FTS RI LP +Q RF +TN + C++S CK DI Sbjct: 145 FTSQRISLPFDQDRFLRTNYTRCLLS-CKPTDI 176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,192,527 Number of Sequences: 37544 Number of extensions: 228697 Number of successful extensions: 229 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 229 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -