BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120754.seq (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 0.69 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 0.69 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 2.8 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.8 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 8.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 8.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 8.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 8.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 8.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.5 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 8.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.5 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 8.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 8.5 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 299 PSSLGMAKGVSLPYFQVNDESQASRLIS 382 P+S+G++ VSLP F+V Q + IS Sbjct: 174 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 201 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 25.0 bits (52), Expect = 0.69 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 299 PSSLGMAKGVSLPYFQVNDESQASRLIS 382 P+S+G++ VSLP F+V Q + IS Sbjct: 113 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 140 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 576 YFSTPPFDTVLYDNIRTVRKDNKTALL 656 +F P D LYD +R +KD + ++ Sbjct: 37 FFDLLPEDPKLYDKMRPPKKDGQATVV 63 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 206 HFHQSADAVLEGVRAGVKPPLSSEAPSAYLTPSSL 310 H ++ +L+G AGV+P +S P A + SL Sbjct: 5 HEYRLTKYLLDGYDAGVRPAENSSQPLAVVFGLSL 39 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHDFQH 226 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 196 SKKYATSSNSLRSRTHGFQH 215 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 103 SRPYASSYPPLRSRLHQPDH 162 S+ YA+S LRSR H H Sbjct: 207 SKKYATSSNSLRSRTHGFQH 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,040 Number of Sequences: 438 Number of extensions: 3862 Number of successful extensions: 27 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -