BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120752.seq (695 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL353596-3|CAI17914.1| 632|Homo sapiens HBS1-like (S. cerevisia... 30 6.9 AJ459827-1|CAD30874.1| 632|Homo sapiens HBS1-like protein protein. 30 6.9 >AL353596-3|CAI17914.1| 632|Homo sapiens HBS1-like (S. cerevisiae) protein. Length = 632 Score = 30.3 bits (65), Expect = 6.9 Identities = 9/39 (23%), Positives = 25/39 (64%) Frame = +3 Query: 120 RYKIETCTNGNFNVYKVYVYFRQIKNQKIEKLDASMVVS 236 RY +++C ++YK ++Y RQ+++ K +++ + ++ Sbjct: 570 RYPLKSCKRRTLDLYKTFLYSRQVQDVKDKEISPLVAIT 608 >AJ459827-1|CAD30874.1| 632|Homo sapiens HBS1-like protein protein. Length = 632 Score = 30.3 bits (65), Expect = 6.9 Identities = 9/39 (23%), Positives = 25/39 (64%) Frame = +3 Query: 120 RYKIETCTNGNFNVYKVYVYFRQIKNQKIEKLDASMVVS 236 RY +++C ++YK ++Y RQ+++ K +++ + ++ Sbjct: 570 RYPLKSCKRRTLDLYKTFLYSRQVQDVKDKEISPLVAIT 608 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,048,724 Number of Sequences: 237096 Number of extensions: 1972507 Number of successful extensions: 7631 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7631 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -