BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120751.seq (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 31 0.88 SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 31 0.88 SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) 29 2.7 SB_28707| Best HMM Match : rve (HMM E-Value=0.011) 28 6.2 SB_9027| Best HMM Match : Phage_fiber_2 (HMM E-Value=5.8) 28 6.2 SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) 28 8.2 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 31.1 bits (67), Expect = 0.88 Identities = 19/88 (21%), Positives = 34/88 (38%) Frame = +3 Query: 234 VCQIAMQICFSVAEIKNYFMQPIDRLTIIPVLELDTCKHQLCSMCXXXXXXXXXXPCPLC 413 +CQ + + K F+ P ++ + + L TCKH C C CP+C Sbjct: 463 ICQEELAEPIMLRTCKVCFVMPTCQVKLAKQIMLRTCKHIFCEDC-ISLWFDREQTCPMC 521 Query: 414 RVESLHFNVYSINRNVVDVIKCSVTSVA 497 R ++ V + SV +++ Sbjct: 522 RARVAGDPMWRDGTTAAAVARLSVATLS 549 >SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 31.1 bits (67), Expect = 0.88 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +1 Query: 49 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 210 RR C FW + K L C+T +Q TL+ A A W+++ +VLFS N + Sbjct: 524 RRARECIFWPGMPAEIKQLASVCDACQTFAKAQQKETLIAIEAKAPWEIVGVVLFSWNNK 583 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 31.1 bits (67), Expect = 0.88 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 342 CKHQLCSMCXXXXXXXXXXPCPLCRV 419 C+H+ C MC CP+CR+ Sbjct: 52 CEHEFCKMCFTQNVQEANLQCPMCRI 77 >SB_47411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 288 FMQPIDRLTIIPVLELDTCKHQLC 359 F QP RL+ IPV+E C H +C Sbjct: 47 FTQPCPRLSGIPVVEASVCHHIIC 70 >SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13) Length = 637 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Frame = +1 Query: 49 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 210 RR C FW + K L C+T +Q +TL+ A A W+++ + LFS N + Sbjct: 450 RRARECIFWPGMSAEIKQLASVCDACQTFAKAQQKKTLITIEAKAPWEIVGVDLFSWNNK 509 >SB_28707| Best HMM Match : rve (HMM E-Value=0.011) Length = 173 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Frame = +1 Query: 49 RRTFRC-FW-----DTK*LIQKTTFCETTLYQEQIRTLLWAAASAHWQVLRLVLFSANRR 210 RR C FW + K L C+T +Q TL+ A A W+++ + LFS N + Sbjct: 30 RRARECIFWPGMSAEIKQLASVCDACQTFSKAQQKETLITKEAKAPWEIVGVDLFSWNNK 89 >SB_9027| Best HMM Match : Phage_fiber_2 (HMM E-Value=5.8) Length = 320 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +2 Query: 530 ASLASVLFEKSLLDDAEDSNNAANSDDTMAV*ITSDTKKA 649 A A ++ S+ DD+E++ N A++DDT+ + +D + + Sbjct: 2 AQAAGLVQYDSITDDSEETENHASTDDTVKKKVHADERSS 41 >SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) Length = 542 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 185 WCCSRRTGGGVAA*KWSLSNCNANL 259 + C++ TG + A WS NCN N+ Sbjct: 481 YTCNKETGAKICAPGWSGVNCNQNV 505 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,001,881 Number of Sequences: 59808 Number of extensions: 344708 Number of successful extensions: 839 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 839 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -