BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120747.seq (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0757 + 24267599-24268882 29 3.5 10_07_0161 - 13674631-13675433,13675793-13675862 28 8.0 06_03_0339 - 19687749-19690805 28 8.0 >06_03_0757 + 24267599-24268882 Length = 427 Score = 29.1 bits (62), Expect = 3.5 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 325 NWRSANTWLCSAPWK*PSRCWK 390 +WR A W+C PW + W+ Sbjct: 348 SWRPAGPWVCFNPWPAQQQAWR 369 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 27.9 bits (59), Expect = 8.0 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +1 Query: 325 NWRSANTWLCSAPWK*PSRCWK 390 +WR A W+C PW W+ Sbjct: 229 SWRPAGPWVCFNPWPAQQLAWR 250 >06_03_0339 - 19687749-19690805 Length = 1018 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/64 (25%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +2 Query: 194 SNATKFERSPKL*TAMKRSKNLRIG--RI*FKKSKQFRKL*NSEN*IGAQQIHGYAQHPG 367 +N T +RS + MKR+ ++RIG R+ +++S++ + + + +H QH Sbjct: 114 ANMTLTDRSKRSVYDMKRNASVRIGSARVPYQQSRRTAPVRPTTTPVNLHNVHQSQQHKP 173 Query: 368 NDPA 379 ++P+ Sbjct: 174 SNPS 177 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,489,295 Number of Sequences: 37544 Number of extensions: 326607 Number of successful extensions: 809 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -