BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120743.seq (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 154 2e-39 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 23 6.8 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 23 6.8 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 9.0 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 154 bits (374), Expect = 2e-39 Identities = 75/141 (53%), Positives = 89/141 (63%) Frame = +1 Query: 244 GCLQYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQXXXX 423 G +Y+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK Sbjct: 2 GAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFSI 61 Query: 424 XXXXXXXXXXXXXXXXXATYGKPKXXWCHQLKPTRNLQSIAXEXXXXXXXXXXXXSSYWV 603 TYGKPK +QLKP R LQS+A E +SYWV Sbjct: 62 FRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYWV 121 Query: 604 AQDSSYKYFEVILVDPSHKAI 666 AQD+++KYFEVI+VDP + AI Sbjct: 122 AQDAAHKYFEVIMVDPPNNAI 142 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 192 EVTSSVWPQKRLDWTQIWHCEN 127 EVT S + R DW ++WH E+ Sbjct: 28 EVTFS--ERTRADWEKVWHQES 47 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 192 EVTSSVWPQKRLDWTQIWHCEN 127 EVT S + R DW ++WH E+ Sbjct: 28 EVTFS--ERTRADWEKVWHQES 47 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 363 PGSAVHTSQLTVLPYPHTQQKTH 295 PGS +SQ + + H QQ+ H Sbjct: 14 PGSGASSSQRSPFHHHHQQQQNH 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,095 Number of Sequences: 2352 Number of extensions: 14541 Number of successful extensions: 36 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -