BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120742.seq (694 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 23 3.1 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 3.1 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 4.1 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 7.2 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 7.2 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 487 IAETSLKCDKLKIKIKYTTSPSATAL 564 I ETSL+ D+ K+ K SP+ AL Sbjct: 104 INETSLQLDENKLDKKNDDSPALRAL 129 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 487 IAETSLKCDKLKIKIKYTTSPSATAL 564 I ETSL+ D+ K+ K SP+ AL Sbjct: 104 INETSLQLDENKLDKKNDDSPALRAL 129 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 487 IAETSLKCDKLKIKIKYTTSPSATAL 564 I ETSL+ D+ K+ K SP+ AL Sbjct: 104 INETSLQLDENKLDKKDDDSPALRAL 129 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 216 VMGAFSPLDPSSFRGLNK 269 V AF+P PS+ RG +K Sbjct: 116 VAAAFAPQGPSTGRGASK 133 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 7.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +2 Query: 260 PEQAVIKHVTLSLN---VDFENKVLNGSATLDVDVLQDIGDVVL 382 P + K TL L +DF VL+ LDVD++ ++ V+ Sbjct: 127 PSDKLSKIQTLKLAARYIDFLYHVLSNENALDVDLIGNVCSYVV 170 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,799 Number of Sequences: 336 Number of extensions: 2758 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -