BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120731.seq (689 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F1D61A Cluster: PREDICTED: hypothetical protein;... 33 5.0 UniRef50_Q6VZJ3 Cluster: CNPV154 variola B22R-like protein; n=3;... 33 6.6 UniRef50_Q8I3T3 Cluster: Putative uncharacterized protein PFE087... 33 8.7 >UniRef50_UPI0000F1D61A Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 639 Score = 33.5 bits (73), Expect = 5.0 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -2 Query: 472 SYTVSLGINFSYNFRPQIAQHKFNVASSFIDKVKIKTSTYFTSFE 338 +Y S+G +SY++ PQ+ Q + +V S ID++ + + T E Sbjct: 349 NYLSSIGSAYSYSYYPQVTQERQSVLSPSIDELSSRDEMFSTDVE 393 >UniRef50_Q6VZJ3 Cluster: CNPV154 variola B22R-like protein; n=3; Avipoxvirus|Rep: CNPV154 variola B22R-like protein - Canarypox virus (CNPV) Length = 1928 Score = 33.1 bits (72), Expect = 6.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 88 YFRLELFENSQYLDNFCQNYSINSILIIQFKCYN 189 YF L + E+ Y DN C N +++ ++I F N Sbjct: 146 YFNLPVMEHVSYFDNGCNNVTVDEVIIYNFSVGN 179 >UniRef50_Q8I3T3 Cluster: Putative uncharacterized protein PFE0875c; n=2; Plasmodium|Rep: Putative uncharacterized protein PFE0875c - Plasmodium falciparum (isolate 3D7) Length = 895 Score = 32.7 bits (71), Expect = 8.7 Identities = 23/70 (32%), Positives = 35/70 (50%) Frame = +3 Query: 189 FSFFLRVYNQK*HANVILFQFHYGVYALQSNLLNSINPHYLRIL*IVTTISKLVKYVDVL 368 F FF Y H + ++ + + +YA LLN P ++ I+ T+ + KYVD L Sbjct: 22 FFFFFFFYILLIHKYIYIYMYIF-IYAF-IYLLNLYTPMMQKLNTIMNTLGENKKYVDYL 79 Query: 369 ILTLSIKLLA 398 I T +LLA Sbjct: 80 IRTEQFELLA 89 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,307,618 Number of Sequences: 1657284 Number of extensions: 11545456 Number of successful extensions: 25606 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25598 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -