BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120731.seq (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 30 0.27 SPBPB2B2.12c |||UDP-glucose 4-epimerase|Schizosaccharomyces pomb... 26 4.5 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 30.3 bits (65), Expect = 0.27 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 664 GGASHPRIVIKYYTDFRSLTLSQQTAQ*PKHSKYPKRLYL 545 G SHP +V++ Y SLTL A S PK++ L Sbjct: 155 GSESHPHLVVEVYPPIFSLTLLSTNAVDANESHKPKKISL 194 >SPBPB2B2.12c |||UDP-glucose 4-epimerase|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 205 EYTIKNNMLMLSYFSFIMEFT 267 +YTIKNN L + Y S I E++ Sbjct: 500 KYTIKNNSLEIEYKSVIPEYS 520 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,662,388 Number of Sequences: 5004 Number of extensions: 53956 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -