BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120731.seq (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 3.9 Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase pr... 23 9.1 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 9.1 AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding pr... 23 9.1 AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding pr... 23 9.1 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 164 LLFNLNVIIFVLSKSIQSKITC*CYLISVSLWSL 265 +LF+L + F + IQ K+ C L+ W L Sbjct: 353 ILFSLPITYFYEERLIQGKMQCWIDLVEAWRWQL 386 >Z49813-1|CAA89967.1| 247|Anopheles gambiae serine proteinase protein. Length = 247 Score = 23.0 bits (47), Expect = 9.1 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 7/41 (17%) Frame = +3 Query: 333 TISKLVKYVDVLILTL----SIKLLA---TLNLCCAI*GRK 434 T+ LV++VDV ILTL S+K A T N+ CA G++ Sbjct: 145 TLPALVQHVDVPILTLDQCRSMKYRASRITSNMLCAGKGKQ 185 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 9.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 371 FNLIDKTACHIELVLCYLRTKIVTKINSQTDCIRCKLK 484 F LID+ AC +C L T + + D I C LK Sbjct: 76 FQLIDRYACARYGSICGLATCNLLLDDELDDDIECMLK 113 >AY146742-1|AAO12102.1| 154|Anopheles gambiae odorant-binding protein AgamOBP7 protein. Length = 154 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 119 CEFSNNSRRKYNIIYVTICLWLII 48 CE+SN + N++ V + L + I Sbjct: 2 CEYSNTRNKMSNLVVVLVLLTMYI 25 >AF437890-1|AAL84185.1| 154|Anopheles gambiae odorant binding protein protein. Length = 154 Score = 23.0 bits (47), Expect = 9.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 119 CEFSNNSRRKYNIIYVTICLWLII 48 CE+SN + N++ V + L + I Sbjct: 2 CEYSNTRNKMSNLVVVLVLLTMYI 25 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,728 Number of Sequences: 2352 Number of extensions: 13751 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -