BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120722.seq (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 1.3 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 1.3 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 1.3 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 24 3.9 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 24 5.1 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 533 SVANLLFNNYKYHDNIASNNNAENLKKVKKEDGSMH 640 S+ N NN ++N +SNNN + + S+H Sbjct: 191 SLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNSLH 226 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 533 SVANLLFNNYKYHDNIASNNNAENLKKVKKEDGSMH 640 S+ N NN ++N +SNNN + + S+H Sbjct: 191 SLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNSLH 226 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 533 SVANLLFNNYKYHDNIASNNNAENLKKVKKEDGSMH 640 S+ N NN ++N +SNNN + + S+H Sbjct: 143 SLPNASSNNSNNNNNSSSNNNNNTISSNNNNNNSLH 178 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 24.2 bits (50), Expect = 3.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 533 SVANLLFNNYKYHDNIASNNNAENLKKVKKEDGSMH 640 S+ N NN ++N + NNN + + S+H Sbjct: 191 SLPNASSNNSNNNNNSSGNNNNNTISSNNNNNNSLH 226 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 23.8 bits (49), Expect = 5.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 629 RPPS*PFLNFPRYYYSQYCHDIYNY 555 R P P + YYY+ YC +I ++ Sbjct: 151 RKPKPPRIYNNNYYYNYYCRNISHH 175 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,923 Number of Sequences: 2352 Number of extensions: 14436 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -