BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120719.seq (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_50623| Best HMM Match : NAD_Gly3P_dh_C (HMM E-Value=0) 29 3.6 SB_53411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_59513| Best HMM Match : PSK_trans_fac (HMM E-Value=9.5) 28 6.4 SB_43814| Best HMM Match : RRM_1 (HMM E-Value=1.3) 28 6.4 SB_2049| Best HMM Match : Ribosomal_LX (HMM E-Value=0.98) 28 6.4 SB_43937| Best HMM Match : Lipoprotein_17 (HMM E-Value=8.4) 28 6.4 SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 32.3 bits (70), Expect = 0.39 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +2 Query: 14 RANVTDAPILFTCFATNWIGKLFQFCRCR*QSPTGLNRI*FGRWCLSK 157 RAN T+AP+L T FA W+ Q+C G + I + CL K Sbjct: 1490 RANCTNAPLLRTLFAKLWLTS--QYCPASLDLVCGTDNITYSNECLMK 1535 >SB_50623| Best HMM Match : NAD_Gly3P_dh_C (HMM E-Value=0) Length = 358 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +3 Query: 357 VFKYKHLNAALINDASCMENVNLSAYMQDCVKISDALILYCLREG 491 + KH+N + D EN++ + + +CVK +D L+ +G Sbjct: 57 IINTKHMNVKYLPDFLIPENIHANPDVVECVKDADILVFVVPHQG 101 >SB_53411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 556 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 208 PCPTSRQTRV*NLASKIFAQTPTTKS 131 PCPTSRQT + + K+ + TP+T + Sbjct: 175 PCPTSRQTHMDGI-KKLVSSTPSTST 199 >SB_59513| Best HMM Match : PSK_trans_fac (HMM E-Value=9.5) Length = 141 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -3 Query: 691 KLISKLWMRKHVSECSTRAGRXTQSHWSIHFQSRNVTC 578 KLI K+W ++ + R R + +W+ F++R + C Sbjct: 70 KLIIKMWEQRLENRRPYRVNRAAEHNWNEIFETRKLEC 107 >SB_43814| Best HMM Match : RRM_1 (HMM E-Value=1.3) Length = 642 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 363 KYKHLNAALINDASCMENVNLSAYMQDCVKISDALILYCLRE 488 ++++ + L+ND CMEN L +Y+Q ++ L C R+ Sbjct: 488 EFENSFSELLNDDHCMENPTLVSYLQKLYNDKESFAL-CFRK 528 >SB_2049| Best HMM Match : Ribosomal_LX (HMM E-Value=0.98) Length = 731 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 366 YKHLNAALINDASCMENVNLSAYMQDCVKISDALILY 476 YKHL A L D C E + ++Q V DAL +Y Sbjct: 144 YKHLLACLGVDRVCAERHGVCGFLQFIVVTHDALRVY 180 >SB_43937| Best HMM Match : Lipoprotein_17 (HMM E-Value=8.4) Length = 311 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 363 KYKHLNAALINDASCMENVNLSAYMQDCVKISDALILYCLRE 488 ++++ + L+ND CMEN L +Y+Q ++ L C R+ Sbjct: 151 EFENSFSELLNDDHCMENPTLVSYLQKLYNDKESFAL-CFRK 191 >SB_10201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1162 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 363 KYKHLNAALINDASCMENVNLSAYMQDCVKISDALILYCLRE 488 ++++ + L+ND CMEN L +Y+Q ++ L C R+ Sbjct: 546 EFENSFSELLNDDHCMENPTLVSYLQKLYNDKESFAL-CFRK 586 >SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +3 Query: 363 KYKHLNAALINDASCMENVNLSAYMQDCVKISDALILYCLRE 488 ++++ + L+ND CMEN L +Y+Q ++ L C R+ Sbjct: 643 EFENSFSELLNDDHCMENPTLVSYLQKLYNDKESFAL-CFRK 683 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,179,474 Number of Sequences: 59808 Number of extensions: 510226 Number of successful extensions: 1170 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1170 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -