BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120711.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 24 1.3 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 24 1.3 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 5.4 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 9.5 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 9.5 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 9.5 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 9.5 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/52 (19%), Positives = 28/52 (53%) Frame = +1 Query: 343 ILMTMATTSGLSSYSSCLPVPVRKIQTSKKLVLECLRLYQVYLEIVRLKTWM 498 +++T A SY+ + V + ++ +L ++LY +Y +++ + T++ Sbjct: 182 LILTQAIFLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVISTFL 233 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/52 (19%), Positives = 28/52 (53%) Frame = +1 Query: 343 ILMTMATTSGLSSYSSCLPVPVRKIQTSKKLVLECLRLYQVYLEIVRLKTWM 498 +++T A SY+ + V + ++ +L ++LY +Y +++ + T++ Sbjct: 108 LILTQAIFLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYFDVIVISTFL 159 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 331 WLGIILMTMATTSGLSSYSSCL 396 W I+++ TS LSS +C+ Sbjct: 226 WTLILILAKCITSSLSSLYTCI 247 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 208 RILH*IIFVTARPPFDAHLRQCLH 137 R+LH + T P+DA QC++ Sbjct: 83 RLLHDLKGRTTSVPYDALTGQCIY 106 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 208 RILH*IIFVTARPPFDAHLRQCLH 137 R+LH + T P+DA QC++ Sbjct: 83 RLLHDLKGRTTSVPYDALTGQCIY 106 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 208 RILH*IIFVTARPPFDAHLRQCLH 137 R+LH + T P+DA QC++ Sbjct: 83 RLLHDLKGRTTSVPYDALTGQCIY 106 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 542 LIHLAAKQILTSFYHIQVFSLTISKYTWYRRKHSN 438 L++ +I +FY++ S KY +++ +N Sbjct: 53 LVNYNVSEISENFYYLPAMSTGPLKYAIFQKNFTN 87 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,147 Number of Sequences: 336 Number of extensions: 3527 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -