BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120711.seq (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0997 - 23203166-23203330,23203627-23203693,23203771-232038... 49 4e-06 03_02_0441 - 8517501-8517701,8518004-8518139,8519995-8520107,852... 43 2e-04 01_07_0224 - 42121011-42122486 28 8.0 >07_03_0997 - 23203166-23203330,23203627-23203693,23203771-23203862, 23204820-23204956,23205050-23205116,23205212-23205278, 23205356-23205441,23206061-23206153,23206337-23206522, 23207316-23207372,23207455-23207582,23207662-23207731, 23207815-23207950,23208378-23208529,23208606-23208680, 23208765-23208929,23209063-23209128,23209229-23209333, 23209929-23210132,23210462-23211715 Length = 1123 Score = 48.8 bits (111), Expect = 4e-06 Identities = 29/98 (29%), Positives = 50/98 (51%), Gaps = 1/98 (1%) Frame = +3 Query: 213 VLPEIAI*AADSAQEQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPEFLQFM 392 V P ++ + ++ LL LQ D + + +KVCD +SELA + + N W E L F+ Sbjct: 99 VWPHLSPAGQAALKQHLLSALQSDPPKPIAKKVCDAISELAALLLPE---NAWAELLPFL 155 Query: 393 FTCASAQD-PNIKEAGIRMFTSVPGVFGNRQTENLDVI 503 F AS + PN++E+ + +F + ++L I Sbjct: 156 FRAASGPEAPNLQESALLIFARLADYIAESLLDHLMTI 193 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 3/66 (4%) Frame = +1 Query: 10 AQFYQLLNTLLSTDNDIRSQAEDAYNNIP---TETKVVHLVNSIQNADIAEDVRQTAAVL 180 A F LL+TL+S+ N R+ AE A++ + E + L +S+ + D+R AAVL Sbjct: 19 AAFDALLSTLMSSSNADRAAAEAAFHRLRGSHPEPLALRLASSLSSPATPADLRAMAAVL 78 Query: 181 LRRLFS 198 LR+L S Sbjct: 79 LRKLLS 84 >03_02_0441 - 8517501-8517701,8518004-8518139,8519995-8520107, 8520189-8520284,8520376-8520590,8520675-8520797, 8520887-8520917,8521020-8521079,8521951-8522106, 8522185-8522274,8522347-8522562,8522671-8522805, 8522898-8523401,8523485-8523700,8524411-8524456, 8524542-8524678,8525059-8525191,8526084-8526358 Length = 960 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/93 (25%), Positives = 49/93 (52%) Frame = +3 Query: 219 PEIAI*AADSAQEQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPEFLQFMFT 398 P++ A S ++ L+ ++ +D S +RR +VVS +A+ + +WPE L F+F Sbjct: 69 PKLPPHAKASLKQALIDSITIDHSHLVRRASANVVSIIAKYAVPA---GEWPELLPFIFQ 125 Query: 399 CASAQDPNIKEAGIRMFTSVPGVFGNRQTENLD 497 C+ + + +E + +F+S+ G +L+ Sbjct: 126 CSQSPQEDHREVALILFSSLTETIGTTFQSHLN 158 Score = 36.7 bits (81), Expect = 0.017 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 25 LLNTLLSTDNDIRSQAEDAYNNIPTETKVV-HLVNSIQNADIAEDVRQTAAVLLRR 189 LL L DND R QAE+ + + +VV LV+ ++ A +VRQ AAVLLR+ Sbjct: 8 LLIQFLMPDNDARRQAEEQIRRLARDPQVVPALVHHLRTAK-TPNVRQLAAVLLRK 62 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 509 MLISALQPNESMALRTQAVKAVGAFILLHDKEPIIQKHFSDVLLPLMQV 655 +L+ LQ S +R A+KAVG+FI + + K F D + ++ V Sbjct: 163 ILLKCLQDEASSRVRIAALKAVGSFIEYVNDGGDVVKIFRDFVPSILNV 211 >01_07_0224 - 42121011-42122486 Length = 491 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 327 ELARNHIDDDGNNQWPEFLQFMF 395 +L ++D G +WP F+QF F Sbjct: 7 DLGGGGVEDGGGKKWPGFVQFFF 29 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,749,132 Number of Sequences: 37544 Number of extensions: 357991 Number of successful extensions: 883 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -