BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120711.seq (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 88 5e-18 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 29 3.5 SB_6595| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_4021| Best HMM Match : FYVE (HMM E-Value=2.3e-32) 28 8.1 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 88.2 bits (209), Expect = 5e-18 Identities = 37/85 (43%), Positives = 57/85 (67%) Frame = +3 Query: 252 QEQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPEFLQFMFTCASAQDPNIKE 431 +E LL + + +R+K+CD VSEL+++ +DDDG N W E L+F+F C ++ +KE Sbjct: 59 KESLLKGIHEEQDSNVRKKICDAVSELSKSFLDDDGYNHWQELLKFLFECCNSPRAELKE 118 Query: 432 AGIRMFTSVPGVFGNRQTENLDVIK 506 + + +F S PGVFGN+Q L+VIK Sbjct: 119 SALNIFCSFPGVFGNQQDHYLNVIK 143 Score = 27.9 bits (59), Expect(2) = 0.021 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 13 QFYQLLNTLLSTDNDIRSQAE 75 QF L+ L+S DND R+QAE Sbjct: 7 QFEALIGQLMSPDNDTRNQAE 27 Score = 27.5 bits (58), Expect(2) = 0.021 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 154 DVRQTAAVLLRRLFSA 201 +VRQ AAVLLRR+F+A Sbjct: 27 EVRQMAAVLLRRIFTA 42 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 306 KVCDVVSELARNHIDDDGNN--QWPEFLQFMFTCASAQDPN 422 ++ D+++++A +D DGN +PEFLQ M DP+ Sbjct: 249 ELMDMMNQIAFLFVDSDGNGAIDFPEFLQLMTKNLQDADPD 289 >SB_6595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 446 VYVCTRCIWK--SSD*KLGCDKRMLISALQPNESMALRTQA 562 V VC C K S+D +GCD L SAL+ ++S + ++A Sbjct: 541 VRVCDSCFSKRASTDEGIGCDMSELASALEDSDSGSQSSRA 581 >SB_4021| Best HMM Match : FYVE (HMM E-Value=2.3e-32) Length = 255 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 446 VYVCTRCIWK--SSD*KLGCDKRMLISALQPNESMALRTQA 562 V VC C K S+D +GCD L SAL+ ++S + ++A Sbjct: 103 VRVCDSCFSKRASTDEGIGCDMSELASALEDSDSGSQSSRA 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,794,631 Number of Sequences: 59808 Number of extensions: 413714 Number of successful extensions: 1029 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -