BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120707.seq (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575... 31 0.88 04_03_0632 + 18200844-18200970,18201134-18201190,18201370-182014... 31 1.2 06_03_1285 - 28993305-28993442,28993559-28993798,28993881-289939... 29 3.5 05_04_0402 - 20991628-20991755,20992461-20992578,20992670-209927... 29 3.5 01_07_0137 - 41381294-41382433 29 3.5 09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,397... 29 4.7 11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005,483... 28 6.2 01_06_1512 + 37881055-37881229,37881388-37881444,37881537-378816... 28 6.2 05_04_0366 - 20663243-20663388,20663467-20663572,20664275-206643... 28 8.2 01_06_1567 + 38293612-38293795,38294467-38294523,38294609-382946... 28 8.2 >06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782, 5757854-5757911 Length = 507 Score = 31.1 bits (67), Expect = 0.88 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 394 DTPPFYFINTRDNFRDNIAEHVFDMLLERHG 486 D P F+NT D+F I +H+ + + E+HG Sbjct: 318 DQCPASFLNTSDDFTARIVDHMVEHIKEQHG 348 >04_03_0632 + 18200844-18200970,18201134-18201190,18201370-18201460, 18201545-18201705,18202176-18202303,18202386-18202523, 18202966-18203058,18203546-18203704 Length = 317 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 546 FNT V P++Y FTIL +I ++I++K Sbjct: 239 FNTAVVSPVYYVMFTIL--TIIANMIMYK 265 >06_03_1285 - 28993305-28993442,28993559-28993798,28993881-28993961, 28994370-28994429,28994523-28994628,28994861-28994921, 28995198-28995246,28995475-28995599,28995809-28995947, 28996432-28996503,28996615-28996742,28997037-28997136, 28997757-28997897,28998116-28998232,28998505-28998609, 28999037-28999153 Length = 592 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 465 HVTRKTWLV*KLSH*NTAFINSLIVNGFKYNQVD 566 H+ K W + + H +T+ + + GFK+N+V+ Sbjct: 553 HIENKGWTIQHVDHKDTSEKEEIRIRGFKFNKVE 586 >05_04_0402 - 20991628-20991755,20992461-20992578,20992670-20992762, 20992841-20992978,20993070-20993197,20993270-20993430, 20993548-20993638,20993731-20993787,20993986-20994139 Length = 355 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAV 525 FNT V PI+Y FT L ++ I+FK + Q++ Sbjct: 248 FNTAVVSPIYYAMFTSL--TILASAIMFKDWSGQSI 281 >01_07_0137 - 41381294-41382433 Length = 379 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -1 Query: 316 WPSLVFVSALMTCTVDKLCSK--LQTRTRKCLICSWLADLS*N*TFATR**SPRPQTC 149 W +L F + VD + K T +R+ + +W D S + ATR PRP+ C Sbjct: 182 WTALWFPKWMQHKYVDVVYHKGAFYTASREAAVTAWAPDASSSGLHATRVTEPRPEKC 239 >09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579, 3973665-3973982,3974565-3974763,3974937-3975202, 3975288-3975574,3976714-3977818,3977900-3978046, 3978146-3978226,3978315-3978540,3978622-3978761, 3979539-3979645,3979739-3979841 Length = 3638 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 254 TTNSYSKMFDM*LVSRFILKLNFCNSLIEPTSTDLSIN 141 T SY K+ + + S F+L + L++P T+LSIN Sbjct: 1092 TLQSYCKLLEYCVNSSFLLSPSHNQLLVQPMVTELSIN 1129 >11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005, 4838405-4838542,4838651-4838778,4838889-4839049, 4839145-4839235,4841437-4841602 Length = 357 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 546 FNT V PI+Y FT L ++ +I+FK Sbjct: 233 FNTAVVSPIYYVMFTSL--TILASVIMFK 259 >01_06_1512 + 37881055-37881229,37881388-37881444,37881537-37881627, 37881759-37881919,37882002-37882129,37882215-37882352, 37882665-37882757,37882858-37882975,37883064-37883194 Length = 363 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAVDK 519 FN V PI+Y FT L ++ I+FK + Q+ K Sbjct: 255 FNAAVVSPIYYAMFTTL--TILASAIMFKDWSGQSASK 290 >05_04_0366 - 20663243-20663388,20663467-20663572,20664275-20664367, 20664520-20664657,20664759-20664886,20664996-20665156, 20665277-20665367,20665460-20665516,20666288-20666444 Length = 358 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 546 FNT V PI+Y FT L ++ +I+FK Sbjct: 249 FNTAVVSPIYYTMFTSL--TILASVIMFK 275 >01_06_1567 + 38293612-38293795,38294467-38294523,38294609-38294699, 38294799-38294959,38295045-38295172,38295291-38295428, 38295717-38295809,38298219-38298324,38298393-38298517 Length = 360 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 632 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 546 FNT V PI+Y FT L ++ +I+FK Sbjct: 258 FNTAVVSPIYYTMFTSL--TILASVIMFK 284 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,331,638 Number of Sequences: 37544 Number of extensions: 299008 Number of successful extensions: 689 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -