BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120700.seq (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0265 - 13638816-13641348,13641432-13641490 28 6.0 02_04_0619 - 24481641-24482291,24482426-24482640,24482770-244831... 28 8.0 >04_03_0265 - 13638816-13641348,13641432-13641490 Length = 863 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 410 NV*IKIFKSTSRDMVCHSLARVASHNLATMWFLSNEDS 297 NV I I S DMV H V MW L NE S Sbjct: 771 NVLIDIIDKKSTDMVSHHQEEVIKMLKLAMWCLQNESS 808 >02_04_0619 - 24481641-24482291,24482426-24482640,24482770-24483154, 24483170-24483258,24485488-24485622,24485833-24487108 Length = 916 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +3 Query: 381 GRLKNFNLNINYDGPVKIFVAATAEQKLLLKKTRDALLPFY 503 G+L F L +N+DG + I+V A +Q + T D ++ Y Sbjct: 824 GKLPPFTLPVNHDGYMHIYVYAYQDQLDDARHTPDGVISDY 864 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,634,832 Number of Sequences: 37544 Number of extensions: 222350 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -