BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120695.seq (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo... 29 0.65 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.0 >SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 29.1 bits (62), Expect = 0.65 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +3 Query: 72 SQHDYDRDQIKRELNSLRRNVHDMCTR-SGTSFDCNKFLRSDD 197 S+ D D ++++ +L +L + R S ++FD +KF+R++D Sbjct: 450 SERDSDVEELREQLENLTALTKKLSERLSSSTFDNSKFIRTED 492 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 697 WFFLQXAQYXWYARXHXDLAVQHVDDIIXPFYAFF 593 WFF + R H + + D + PF+ FF Sbjct: 77 WFFFFFFFFSHCRRFHIAIFIHPYDSNVVPFFCFF 111 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,346,461 Number of Sequences: 5004 Number of extensions: 38042 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -