BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120695.seq (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g28190.1 68418.m03413 hypothetical protein 32 0.32 At3g27290.1 68416.m03411 F-box family protein-related contains w... 27 9.2 At1g67950.3 68414.m07762 RNA recognition motif (RRM)-containing ... 27 9.2 At1g67950.2 68414.m07760 RNA recognition motif (RRM)-containing ... 27 9.2 At1g67950.1 68414.m07761 RNA recognition motif (RRM)-containing ... 27 9.2 >At5g28190.1 68418.m03413 hypothetical protein Length = 839 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +2 Query: 218 DHAXKNCRLQNYQYVSDVKTIKPSNRPLVESGPLVQEAAK 337 +H +C L QY SDVKTI P+N+ + ++Q K Sbjct: 710 NHLQPSCALIRKQYTSDVKTISPANQEEEDLEGMMQRIKK 749 >At3g27290.1 68416.m03411 F-box family protein-related contains weak similarity to PPA [Mus musculus] GP|18568225|gb|AAL75967 Length = 382 Score = 27.5 bits (58), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 201 SCHRCVETCYNQNSCLNAC 145 +C C+E C+ SCLN C Sbjct: 342 ACVVCIERCHECGSCLNDC 360 >At1g67950.3 68414.m07762 RNA recognition motif (RRM)-containing protein Length = 279 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 212 DNDHAXKNCRLQNYQYVSDVKTIKPSNRPLVESGPLVQE 328 D+D N + + VS VKT+K SN L+ S V+E Sbjct: 9 DSDQTQHNILMDSQSTVSGVKTVKISNVSLIVSKKDVKE 47 >At1g67950.2 68414.m07760 RNA recognition motif (RRM)-containing protein Length = 279 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 212 DNDHAXKNCRLQNYQYVSDVKTIKPSNRPLVESGPLVQE 328 D+D N + + VS VKT+K SN L+ S V+E Sbjct: 10 DSDQTQHNILMDSQSTVSGVKTVKISNVSLIVSKKDVKE 48 >At1g67950.1 68414.m07761 RNA recognition motif (RRM)-containing protein Length = 278 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 212 DNDHAXKNCRLQNYQYVSDVKTIKPSNRPLVESGPLVQE 328 D+D N + + VS VKT+K SN L+ S V+E Sbjct: 9 DSDQTQHNILMDSQSTVSGVKTVKISNVSLIVSKKDVKE 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,136,709 Number of Sequences: 28952 Number of extensions: 193372 Number of successful extensions: 410 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -