BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120691.seq (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 26 0.40 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.8 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 25.8 bits (54), Expect = 0.40 Identities = 22/74 (29%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = +1 Query: 172 RTRKNFTTVALICWVKTLWPRRPNNSACRPVHGGGIGDVQHSHSVTV-QSAAGQQLHDSV 348 R ++F V L C ++L R SAC P + H V V Q A LH V Sbjct: 26 RDDEDFVDVTLACDGRSLKAHRVVLSACSPYFRELLKSTPCKHPVIVLQDVAFSDLHALV 85 Query: 349 AQARHSAAKHTERS 390 H +RS Sbjct: 86 EFIYHGEVNVHQRS 99 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = -2 Query: 192 CKIFARTPAANLAQTMPEIYSNRSAGTRAALPCP 91 C+ RTP LAQ E S R P P Sbjct: 1333 CRNSRRTPVPRLAQDSSEDESYRGPSASGGRPVP 1366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,607 Number of Sequences: 438 Number of extensions: 4031 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -