BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120681.seq (691 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-1515|AAF54807.1| 2016|Drosophila melanogaster CG6525-PA... 31 1.1 >AE014297-1515|AAF54807.1| 2016|Drosophila melanogaster CG6525-PA protein. Length = 2016 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/79 (25%), Positives = 37/79 (46%) Frame = -1 Query: 685 KKKIGERTHSPSGVKWLLEPIDIYNVNAQLNLRYKLYIRSQLQQLPHPSNRNALLLHGRI 506 KK++ SP VK P+ + V L+ K+ + + P P + ++ + + Sbjct: 248 KKRVQAIPLSPVQVKVQRLPVKPHQVQQAAQLQPKVQLIRKPIHSPLPRQKPEIIANNSV 307 Query: 505 VRVVVPTRADSQVVLPPVK 449 + PTRA +V+ PPV+ Sbjct: 308 NARLRPTRAPVKVIAPPVQ 326 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,823,954 Number of Sequences: 53049 Number of extensions: 589468 Number of successful extensions: 1525 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -