BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120677.seq (691 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2116|AAF49941.2| 383|Drosophila melanogaster CG5626-PA... 44 2e-04 >AE014296-2116|AAF49941.2| 383|Drosophila melanogaster CG5626-PA protein. Length = 383 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/56 (35%), Positives = 37/56 (66%) Frame = +3 Query: 513 IRQTGGYWQFYGHHQGKKLYLKPEEALFLMESNCLRLNNNGXTMSLQEAYSILLNE 680 +++ G ++ +G+ + KLYL+ EA+FL+E L+L G +S+++AY +LL E Sbjct: 91 VKRKDGKFENFGYSEQGKLYLEYYEAMFLLEVGRLQLEYCGLVVSIEQAYVLLLGE 146 Score = 37.1 bits (82), Expect = 0.022 Identities = 25/78 (32%), Positives = 39/78 (50%) Frame = +1 Query: 277 PDPKLLSGEELVAKGVTRTEGALPIIGLKEVVPNGSWLEQKQIQVALEARKHLIEVNRIE 456 P LS +EL+A TE P GLK G+ E ++++ A E + + V RIE Sbjct: 15 PKNSYLSAQELIAH--RHTEFEPPSGGLKRTKNEGTAAEVEELKRAQEYLRAQLSVPRIE 72 Query: 457 KQGSLSHAEWRNDLRLAE 510 + G + A W + ++AE Sbjct: 73 RLGGRALAIWNEEQQVAE 90 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,575,474 Number of Sequences: 53049 Number of extensions: 539795 Number of successful extensions: 996 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 996 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -