BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120677.seq (691 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100657-3|AAC68961.1| 335|Caenorhabditis elegans Hypothetical ... 31 0.59 AF025469-1|AAG00030.3| 578|Caenorhabditis elegans Hypothetical ... 28 7.2 >AF100657-3|AAC68961.1| 335|Caenorhabditis elegans Hypothetical protein F52C12.3 protein. Length = 335 Score = 31.5 bits (68), Expect = 0.59 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = +3 Query: 510 VIRQTGGYWQFYGHHQGKKLY-LKPEEALFLMESNCLRLN-NNGXTMSLQEAYSIL 671 V + TG + + G GK Y + PEEA++LME+ ++ ++G +SL EA+SIL Sbjct: 29 VTKVTGKHLESMGI-PGKFGYEVYPEEAVYLMETGSATISTSSGRDLSLLEAFSIL 83 >AF025469-1|AAG00030.3| 578|Caenorhabditis elegans Hypothetical protein W09B6.3 protein. Length = 578 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 428 FLASKATCICFCSNQEPFGTTSL 360 F+ SKATCI + SN +P G S+ Sbjct: 66 FIFSKATCIQYPSNFDPIGVGSV 88 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,892,653 Number of Sequences: 27780 Number of extensions: 305835 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -