BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120677.seq (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33240.1 68417.m04731 phosphatidylinositol-4-phosphate 5-kina... 28 6.7 >At4g33240.1 68417.m04731 phosphatidylinositol-4-phosphate 5-kinase family protein similar to SP|Q9Z1T6 FYVE finger-containing phosphoinositide kinase (EC 2.7.1.68) (1- phosphatidylinositol-4-phosphate kinase) (PIP5K) (PtdIns(4)P-5-kinase) {Mus musculus}; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF01363: FYVE zinc finger, PF00118: TCP-1/cpn60 chaperonin family Length = 1756 Score = 27.9 bits (59), Expect = 6.7 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +1 Query: 274 MPDPKLLSGE-ELVAKGVTRTEGALPIIGLKEVVPNGSWLEQKQIQVALEARKHLIEVNR 450 +PD +LL E EL KG + + L P+ S+ +L +RKH++ +R Sbjct: 1271 IPDLRLLGSESELNFKGGPTNDEHTTQVQL----PSPSFYYSLNKNYSLNSRKHIMAEDR 1326 Query: 451 IEKQGSLSHAEWRNDLRL 504 S EWR+ RL Sbjct: 1327 PVYVSSYRELEWRSGARL 1344 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,692,077 Number of Sequences: 28952 Number of extensions: 271664 Number of successful extensions: 607 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -