BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120676.seq (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g67110.1 68414.m07635 cytochrome P450, putative similar to Cy... 44 1e-04 At3g14610.1 68416.m01850 cytochrome P450, putative similar to GB... 38 0.006 At5g38450.1 68418.m04648 cytochrome P450 family protein similar ... 36 0.025 At3g14620.1 68416.m01851 cytochrome P450, putative similar to GB... 34 0.077 At2g46960.2 68415.m05866 cytochrome P450 family protein similar ... 34 0.10 At2g46960.1 68415.m05865 cytochrome P450 family protein similar ... 34 0.10 At3g14690.1 68416.m01858 cytochrome P450, putative similar to GB... 33 0.18 At3g14650.1 68416.m01854 cytochrome P450, putative similar to GB... 33 0.18 At1g31800.1 68414.m03903 cytochrome P450 family protein similar ... 33 0.18 At3g14660.1 68416.m01855 cytochrome P450, putative similar to GB... 32 0.31 At3g14640.1 68416.m01853 cytochrome P450, putative similar to GB... 31 0.54 At3g14630.1 68416.m01852 cytochrome P450, putative similar to GB... 31 0.72 At4g28150.2 68417.m04037 expressed protein 30 1.3 At4g27710.1 68417.m03983 cytochrome P450 family protein contains... 30 1.7 At3g53130.1 68416.m05855 cytochrome P450 family protein similar ... 29 2.9 At3g14680.1 68416.m01857 cytochrome P450, putative similar to GB... 29 2.9 At1g17060.1 68414.m02075 cytochrome P450, putative 41% identical... 28 5.0 At4g23210.1 68417.m03347 protein kinase family protein contains ... 27 8.8 >At1g67110.1 68414.m07635 cytochrome P450, putative similar to Cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; Length = 512 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 523 PAFSSSRLKNMIPLIQQCSKQMVEFLKKFDGKEIEMKQTMGHFTLEVIGACAFG 684 PAF+ RLK + +C+K M E L+K G+E+E+ + M T ++I FG Sbjct: 162 PAFTRDRLKGYAKHMVECTKMMAERLRKEVGEEVEIGEEMRRLTADIISRTEFG 215 >At3g14610.1 68416.m01850 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 37.9 bits (84), Expect = 0.006 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 5/75 (6%) Frame = +1 Query: 475 AKFKGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMV-EFLKKFDGK----EIEMKQT 639 A +KG + + PAF ++KNMIP C ++V ++ K F K E+++ Sbjct: 140 ASYKGDKWASHRRIINPAFHLEKIKNMIPAFYHCCSEVVCQWEKLFTDKESPLEVDVWPW 199 Query: 640 MGHFTLEVIGACAFG 684 + + T +VI AFG Sbjct: 200 LVNMTADVISHTAFG 214 >At5g38450.1 68418.m04648 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus] Length = 518 Score = 35.9 bits (79), Expect = 0.025 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +1 Query: 523 PAFSSSRLKNMIPLIQQCSKQMVEFLKKFDGK---EIEMKQTMGHFTLEVIGACAFG 684 PAF+ RLK + +C+ ++VE L+K G+ E+E+ + M T ++I FG Sbjct: 161 PAFTGERLKGYARHMVECTSKLVERLRKEVGEGANEVEIGEEMHKLTADIISRTKFG 217 >At3g14620.1 68416.m01851 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 515 Score = 34.3 bits (75), Expect = 0.077 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 5/75 (6%) Frame = +1 Query: 475 AKFKGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMVEFLKKF-----DGKEIEMKQT 639 A ++G + + + P+F +LK MIP + +M+ +K EI++ Sbjct: 145 ALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVWPY 204 Query: 640 MGHFTLEVIGACAFG 684 +G T +VI AFG Sbjct: 205 LGDLTSDVISRTAFG 219 >At2g46960.2 68415.m05866 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; contains Pfam profile: PF00067: Cytochrome P450; supported by cDNA: gi_13605860_gb_AF367329.1_AF367329 Length = 519 Score = 33.9 bits (74), Expect = 0.10 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +1 Query: 484 KGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMVEFLKKFDGKE--------IEMKQT 639 +G R L PAFS RLK M ++ C+ +M+E +K KE EM + Sbjct: 147 EGADWVRHRRILNPAFSIDRLKIMTTVMVDCTLKMLEEWRKESTKEETEHPKIKKEMNEE 206 Query: 640 MGHFTLEVIGACAFG 684 T ++I AFG Sbjct: 207 FQRLTADIIATSAFG 221 >At2g46960.1 68415.m05865 cytochrome P450 family protein similar to cytochrome P450 72A1 (SP:Q05047) [Catharanthus roseus]; contains Pfam profile: PF00067: Cytochrome P450; supported by cDNA: gi_13605860_gb_AF367329.1_AF367329 Length = 403 Score = 33.9 bits (74), Expect = 0.10 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = +1 Query: 484 KGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMVEFLKKFDGKE--------IEMKQT 639 +G R L PAFS RLK M ++ C+ +M+E +K KE EM + Sbjct: 31 EGADWVRHRRILNPAFSIDRLKIMTTVMVDCTLKMLEEWRKESTKEETEHPKIKKEMNEE 90 Query: 640 MGHFTLEVIGACAFG 684 T ++I AFG Sbjct: 91 FQRLTADIIATSAFG 105 >At3g14690.1 68416.m01858 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 33.1 bits (72), Expect = 0.18 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 5/82 (6%) Frame = +1 Query: 454 TISESVFAKFKGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMV-EFLKKFDGK---- 618 TI A + G + + + PAF ++KNM+P Q +++V E+ + K Sbjct: 134 TIIAKGLANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSCREVVGEWDQLVSDKGSSC 193 Query: 619 EIEMKQTMGHFTLEVIGACAFG 684 E+++ + T +VI AFG Sbjct: 194 EVDVWPGLVSMTADVISRTAFG 215 >At3g14650.1 68416.m01854 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 33.1 bits (72), Expect = 0.18 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 5/89 (5%) Frame = +1 Query: 433 HFEQYGTTISESVFAKFKGLRMERRCSTLTPAFSSSRLKNMIPLI-QQCSKQMVEFLKKF 609 H G I+ V + + G + + + PAF ++KNM+P Q CS+ + ++ K Sbjct: 128 HTFPLGRLIATGVLS-YDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEIVCKWDKLV 186 Query: 610 DGK----EIEMKQTMGHFTLEVIGACAFG 684 K E+++ + T +VI AFG Sbjct: 187 SDKESSCEVDVWPGLVSMTADVISRTAFG 215 >At1g31800.1 68414.m03903 cytochrome P450 family protein similar to Cytochrome P450 97B2 (SP:048921) [Glycine max]; contains Pfam profile: PF00067: Cytochrome P450 Length = 595 Score = 33.1 bits (72), Expect = 0.18 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +1 Query: 502 RRCSTLTPAFSSSRLKNMIPLIQQCSKQMVEFLKK--FDGKEIEMKQTMGHFTLEVIGAC 675 RR + PA + MI L + S ++ + L G+E+EM+ TL++IG Sbjct: 199 RRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKA 258 Query: 676 AF 681 F Sbjct: 259 VF 260 >At3g14660.1 68416.m01855 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 32.3 bits (70), Expect = 0.31 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 5/73 (6%) Frame = +1 Query: 481 FKGLRMERRCSTLTPAFSSSRLKNMIPLI-QQCSKQMVEFLKKFDGK----EIEMKQTMG 645 + G + + + PAF ++KNM+P Q CS+ + E+ K K E+++ + Sbjct: 143 YDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSEIVGEWDKLVTDKQSSCEVDIWPWLV 202 Query: 646 HFTLEVIGACAFG 684 T +VI AFG Sbjct: 203 SMTADVISRTAFG 215 >At3g14640.1 68416.m01853 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 514 Score = 31.5 bits (68), Expect = 0.54 Identities = 21/89 (23%), Positives = 43/89 (48%), Gaps = 4/89 (4%) Frame = +2 Query: 338 TFDGRRPVLHILDPELIKAIMIRDFDHFTDRNTLNSMEPRYLSRSLLNLKGLEW----KG 505 T+ G +P + I+DPELIK + + +D+ + L R ++ ++N G +W + Sbjct: 98 TWLGPKPTITIMDPELIKEVFNKVYDYPKAQTFLLG---RLIATGIINYDGDKWAKHRRI 154 Query: 506 VAAH*HLPSVRHA*KI*FHSYNSVLSRWS 592 + H+ +++ S + V+ WS Sbjct: 155 INPAFHIEKIKNMVPAFHQSCSDVVGEWS 183 >At3g14630.1 68416.m01852 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 508 Score = 31.1 bits (67), Expect = 0.72 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%) Frame = +1 Query: 451 TTISESVFAKFKGLRMERRCSTLTPAFSSSRLKNMIP-LIQQCSKQMVEFLKKFDGK--- 618 T++ A G + + + PAF ++KNM+P + C + M E+ K K Sbjct: 129 TSLLTDGLANADGDKWVKHRKIINPAFHFEKIKNMVPTFYKSCIEVMCEWEKLVSDKGSS 188 Query: 619 -EIEMKQTMGHFTLEVIGACAFG 684 E+++ + + T +VI AFG Sbjct: 189 CELDVWPWIVNMTGDVISRTAFG 211 >At4g28150.2 68417.m04037 expressed protein Length = 283 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 469 VFAKFKGLRMERRCST-LTPAFSSSRLKNMIPLIQQCSKQMVEFLKKFD 612 VF L RC+T + PA+S ++KN+ PL Q VE+ + D Sbjct: 3 VFDSESNLDRFLRCTTPIVPAYSLPKIKNLNPLWYPLESQSVEYFRLGD 51 >At4g27710.1 68417.m03983 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 518 Score = 29.9 bits (64), Expect = 1.7 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = +1 Query: 517 LTPAFSSSRLKNMIPLIQQCSKQMVEFLKK--FDGK---EIEMKQTMGHFTLEVIGACAF 681 L PAFS RLK M + C+ ++ E +K +G+ +IE+ + T ++I AF Sbjct: 159 LNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRNGEVLIKIEISKEFHKLTADIIATTAF 218 Query: 682 G 684 G Sbjct: 219 G 219 >At3g53130.1 68416.m05855 cytochrome P450 family protein similar to Cytochrome P450 97B2 (SP:048921) [Glycine max] Length = 539 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 3/75 (4%) Frame = +1 Query: 466 SVFAKFKGLRMERRCSTLTPAFSSSRLKNMIPLIQ-QCSKQMVEFLKKF--DGKEIEMKQ 636 S FA +G R + P+ L ++ + +C++++VE L+ + DG + M+ Sbjct: 155 SGFAIAEGPLWTARRRAVVPSLHRRYLSVIVERVFCKCAERLVEKLQPYAEDGSAVNMEA 214 Query: 637 TMGHFTLEVIGACAF 681 TL+VIG F Sbjct: 215 KFSQMTLDVIGLSLF 229 >At3g14680.1 68416.m01857 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 512 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Frame = +1 Query: 517 LTPAFSSSRLKNMIPLI-QQCSKQMVEFLKKFDGK----EIEMKQTMGHFTLEVIGACAF 681 + PAF ++KNM+ + + CS+ + E+ K K E+++ + T +VI AF Sbjct: 155 INPAFHLEKIKNMVHVFHESCSELVGEWDKLVSDKGSSCEVDVWPGLTSMTADVISRTAF 214 Query: 682 G 684 G Sbjct: 215 G 215 >At1g17060.1 68414.m02075 cytochrome P450, putative 41% identical to Cytochrome P450 [Catharanthus roseus] (gi|404690) Length = 476 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 484 KGLRMERRCSTLTPAFSSSRLKNMIPLIQQCSKQMVE 594 +G + + S L PAF LK+++P K+M+E Sbjct: 146 EGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLE 182 >At4g23210.1 68417.m03347 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 610 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -2 Query: 626 SISFP-SNFLRN-STICLEHCCMSGIIFFKRDELKAGVNVLQRLSILSP 486 S S P NF+ STI + HCC + I+ + +G+ V+++ + P Sbjct: 561 SFSSPVQNFVTYVSTIIVSHCCCNCKIWIRSLNFVSGLEVMEKRDTIKP 609 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,057,271 Number of Sequences: 28952 Number of extensions: 252065 Number of successful extensions: 649 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -