BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120672.seq (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78419-9|CAB01707.1| 1153|Caenorhabditis elegans Hypothetical pr... 30 1.8 Z73907-3|CAA98126.1| 1153|Caenorhabditis elegans Hypothetical pr... 30 1.8 >Z78419-9|CAB01707.1| 1153|Caenorhabditis elegans Hypothetical protein F29D11.2 protein. Length = 1153 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 260 VVSSSIWHVTAAPPVNTNKPPFSQTTASKQSLINANFA 147 +V + +PP NT KPP TTA++ + + A A Sbjct: 1104 LVEEDALEILKSPPRNTKKPPSRPTTATRPTAVAARTA 1141 >Z73907-3|CAA98126.1| 1153|Caenorhabditis elegans Hypothetical protein F29D11.2 protein. Length = 1153 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 260 VVSSSIWHVTAAPPVNTNKPPFSQTTASKQSLINANFA 147 +V + +PP NT KPP TTA++ + + A A Sbjct: 1104 LVEEDALEILKSPPRNTKKPPSRPTTATRPTAVAARTA 1141 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,388,841 Number of Sequences: 27780 Number of extensions: 287807 Number of successful extensions: 867 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -