BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120667.seq (694 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2654|AAZ66062.1| 166|Drosophila melanogaster CG33687-P... 30 2.6 BT025148-1|ABE73318.1| 270|Drosophila melanogaster IP04354p pro... 29 6.0 >AE014296-2654|AAZ66062.1| 166|Drosophila melanogaster CG33687-PA protein. Length = 166 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 66 NFSILNCSCFEGRFLKNEFCRLANLNSLHEWED---KLYPEPDKNIVV 200 +F+ L C + F E CR+ +N H++ D KLY P NI++ Sbjct: 13 SFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMI 60 >BT025148-1|ABE73318.1| 270|Drosophila melanogaster IP04354p protein. Length = 270 Score = 29.1 bits (62), Expect = 6.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 388 VFAKCCQIYCCVCECLRIXC 329 +++ CC YCC C C C Sbjct: 5 IYSCCCCCYCCCCTCCCCCC 24 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,076,681 Number of Sequences: 53049 Number of extensions: 784714 Number of successful extensions: 2525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2514 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3026039247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -