BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120662.seq (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF471259-1|AAQ05434.1| 122|Homo sapiens Ig heavy chain variable... 31 5.1 Y12042-1|CAA72773.1| 90|Homo sapiens immunoglobulin heavy chai... 30 6.7 >AF471259-1|AAQ05434.1| 122|Homo sapiens Ig heavy chain variable region, VH3 family protein. Length = 122 Score = 30.7 bits (66), Expect = 5.1 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +2 Query: 551 ENVNLSAYMQ-DCVKISDALILYCLREGR 634 EN S Y+Q D +++ D + YC REGR Sbjct: 72 ENAMNSLYLQIDSLRVGDTAVYYCAREGR 100 >Y12042-1|CAA72773.1| 90|Homo sapiens immunoglobulin heavy chain protein. Length = 90 Score = 30.3 bits (65), Expect = 6.7 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 551 ENVNLSAYMQ-DCVKISDALILYCLREGRVQELKLIAHSIPW 673 +N S Y+Q ++ D + YC REG + L + + PW Sbjct: 49 DNARNSLYLQMSSLRAEDTAVYYCAREGNILPLTVTSWFDPW 90 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,244,313 Number of Sequences: 237096 Number of extensions: 2050162 Number of successful extensions: 4188 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4188 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -