BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120659.seq (696 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O43052 Cluster: Rho-type GTPase-activating protein 1; n... 33 8.8 >UniRef50_O43052 Cluster: Rho-type GTPase-activating protein 1; n=1; Schizosaccharomyces pombe|Rep: Rho-type GTPase-activating protein 1 - Schizosaccharomyces pombe (Fission yeast) Length = 1150 Score = 32.7 bits (71), Expect = 8.8 Identities = 21/88 (23%), Positives = 40/88 (45%) Frame = -3 Query: 598 IRNGEITKSLYCSSREDRFVGVKM*SYKS*FAGRTYLKTLKIYYFNSAERIPFGIISIYC 419 + NGE TKS+ C+ + R++ + S + + Y A+ + ++SI+ Sbjct: 335 VSNGEFTKSVICAQKFIRYIEILFKGIDSLETILSSFHAKSMPYVREAKLLCKKLVSIFA 394 Query: 418 RHNNAHFSKITTVLLIVKFVS*FIFLSY 335 H S I V ++ F+S F L++ Sbjct: 395 LLAKCHNSDIRDVAIVQDFLSLFTGLAH 422 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,126,946 Number of Sequences: 1657284 Number of extensions: 11245610 Number of successful extensions: 17856 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17851 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -