BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120656.seq (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple ca... 26 5.9 >SPBP19A11.07c ||SPBP4H10.02c|human down-regulated in multiple cancers-1 homolog 2|Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.8 bits (54), Expect = 5.9 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = +3 Query: 57 VKHDRKVMSFV--FQNLI*EMMSLVF---QN*TRFTSRILRVKHDQEMMSFIIKIKI 212 +K +R++++F+ F+ + E + +F N RFT ++ K EMM ++ I + Sbjct: 334 LKKERQIITFMGDFKRCVVESLCFLFLLLTNQPRFTDELVNFKSSNEMMMNLLFIHV 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,207,179 Number of Sequences: 5004 Number of extensions: 38215 Number of successful extensions: 67 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -