BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120655.seq (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1289 + 25531531-25531995 30 2.0 02_05_0433 - 28939817-28940146 29 3.5 01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602... 29 4.6 06_03_1494 + 30554997-30555608,30555707-30555915,30556006-305561... 28 8.1 06_02_0352 + 15083174-15083433,15083973-15084108 28 8.1 04_01_0206 + 2507827-2508705,2508844-2509902 28 8.1 >07_03_1289 + 25531531-25531995 Length = 154 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 129 SKASPTEIARRPTACPFEPASFAVCTCSRQT 37 SK PT A RPTA PA V C QT Sbjct: 99 SKLQPTPAAARPTATGAPPAMVVVSACQFQT 129 >02_05_0433 - 28939817-28940146 Length = 109 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/51 (29%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Frame = -3 Query: 161 HNIDGRQVDCGRRHLQQRSHGVQQRVRLNLRHLRSARVVVKRGF-EQFEQR 12 H +D R+ + RH Q+R+ ++Q+ R +++ L R+++++ + E+ EQR Sbjct: 32 HRLDVRRQEALERHAQERA-AIEQQWRQSMQALERERLMLEQAWMEREEQR 81 >01_06_0668 + 31058497-31059510,31059609-31059676,31060189-31060270, 31060339-31060431,31060516-31060668,31060900-31060968, 31061091-31061184,31061594-31061677,31062133-31062221, 31062340-31062456,31062567-31062707,31062823-31063005 Length = 728 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 212 NSAVTKRGFTARQTPTLEELLIERGEKIQ 298 +SAV GF A TP L+ELL E +++Q Sbjct: 444 DSAVYGAGFYASATPQLDELLKEASKQVQ 472 >06_03_1494 + 30554997-30555608,30555707-30555915,30556006-30556155, 30556254-30556312,30556852-30556961,30557216-30557322, 30557443-30557581,30557705-30557821,30557918-30558025, 30558221-30558292,30558783-30558948,30559044-30559165, 30559245-30559382,30559462-30559604,30559699-30559761, 30560107-30560170,30560238-30560373,30560478-30560551, 30560640-30560734,30560829-30560860,30560973-30561175 Length = 972 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = -1 Query: 586 ELPNICLTRLGRLNFCCCVS*YFPSPKYVIVILNVELAI---GHGIVFHGRVKHGIGRIV 416 +L IC LG ++ CCC F K ++ L +++ + G V V I + Sbjct: 618 DLKRICEIDLGLVSQCCCTKQVFKMNKQILANLALKINVKVGGRNTVLVDAVSRRIPLVT 677 Query: 415 IHPT 404 PT Sbjct: 678 DRPT 681 >06_02_0352 + 15083174-15083433,15083973-15084108 Length = 131 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 19 SNCSKPRLTTTRADRK*RRFKRTRCWTPCDLCWRCLR 129 + C + + DR+ F +R T C CW+C+R Sbjct: 51 ATCGGEAVVPSPGDRRTVVFATSRATTFCRPCWKCMR 87 >04_01_0206 + 2507827-2508705,2508844-2509902 Length = 645 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 122 HLQQRSHGVQQRVRLNLRHLRSARVVVKRGFEQF 21 +LQ R H +++ L+L++ S + KRG F Sbjct: 190 YLQDRDHRIREEEELSLQYAHSLHHICKRGIVNF 223 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,032,764 Number of Sequences: 37544 Number of extensions: 366793 Number of successful extensions: 1016 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -