BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120655.seq (694 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D43949-1|BAA07893.2| 882|Homo sapiens KIAA0082 protein. 31 3.9 BC031890-1|AAH31890.1| 835|Homo sapiens KIAA0082 protein. 31 3.9 AL353597-2|CAI19603.1| 835|Homo sapiens KIAA0082 protein. 31 3.9 >D43949-1|BAA07893.2| 882|Homo sapiens KIAA0082 protein. Length = 882 Score = 31.1 bits (67), Expect = 3.9 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 339 ISVPLLMYCCGCNICIFSPRSIN--NSSRVGVCRAVK 235 + + L+YCC +C+F P + NS R VC+ +K Sbjct: 461 VGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLK 497 >BC031890-1|AAH31890.1| 835|Homo sapiens KIAA0082 protein. Length = 835 Score = 31.1 bits (67), Expect = 3.9 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 339 ISVPLLMYCCGCNICIFSPRSIN--NSSRVGVCRAVK 235 + + L+YCC +C+F P + NS R VC+ +K Sbjct: 414 VGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLK 450 >AL353597-2|CAI19603.1| 835|Homo sapiens KIAA0082 protein. Length = 835 Score = 31.1 bits (67), Expect = 3.9 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 339 ISVPLLMYCCGCNICIFSPRSIN--NSSRVGVCRAVK 235 + + L+YCC +C+F P + NS R VC+ +K Sbjct: 414 VGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLK 450 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,534,392 Number of Sequences: 237096 Number of extensions: 1860122 Number of successful extensions: 8376 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8376 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7951235188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -