BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120652.seq (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6484| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.095 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26) 29 2.7 SB_32738| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-13) 29 2.7 SB_19726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45241| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22003| Best HMM Match : Ank (HMM E-Value=1.8e-39) 29 3.6 SB_45993| Best HMM Match : TEP1_N (HMM E-Value=0.48) 28 8.3 >SB_6484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 34.3 bits (75), Expect = 0.095 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +3 Query: 483 RSDAKIDGGNADLAEANRSLILFANEMIVARRDAETARQDCENAXR 620 R D K+D A L EA + L + I R+D ++ +DCEN R Sbjct: 2 RDDEKVDPAEA-LLEAQQELATLQRQYICLRKDKKSYTEDCENVIR 46 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -2 Query: 307 CGCKYSGSPCFATLSGACAGFGRHAQTSICTCRRRGHVLPVHNLHILNCWRCPW 146 C C Y G+ +S A R A+ +CT R +L +N + NC RC + Sbjct: 175 CVCVYGGTG----ISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTY 224 >SB_46249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = +3 Query: 249 PAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPXAIELQEWL-LEEVIP-QVLC 422 P + + K P HP TVLI +I L + + L I LQ L L+ +IP QVL Sbjct: 316 PLYKSSPLYKSSPPTSTHPSTVLIPLQVLIPLQVLTPLQVLIPLQVLLPLQVLIPLQVLI 375 Query: 423 TXQVRA 440 V A Sbjct: 376 PLHVLA 381 >SB_52713| Best HMM Match : 7tm_1 (HMM E-Value=4.9e-26) Length = 333 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 260 SMCWIWSACSNVDLYLPSTWTRI 192 SMC +++ C N+ L++P T+ I Sbjct: 258 SMCTVYNVCKNIPLHIPQTFLHI 280 >SB_32738| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-13) Length = 323 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 302 VQIQRVALLCHAIWSMCWIWSACS--NVDLYLPST 204 V +QRV ++C +W C I+SA + V +Y P T Sbjct: 157 VTVQRVLIICGGMWVSCSIFSAVTLYGVHVYHPVT 191 >SB_19726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 260 SMCWIWSACSNVDLYLPSTWTRI 192 SMC +++ C N+ L++P T+ I Sbjct: 121 SMCTVYNVCKNIPLHIPQTFLHI 143 >SB_45241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +3 Query: 507 GNADLAEANRSLILFANEMIVARRDAETARQDCE-NAXRETAHWANRMADIAQDVIAKPS 683 G+ D RS AN I ++RD T++ DC+ +A + + N ++ + +I K Sbjct: 46 GSTDRLPFARSTSSLANNTIPSKRDKRTSKHDCDGSANNKRTNKHNDGSNNKRTIITKHD 105 Query: 684 N 686 N Sbjct: 106 N 106 >SB_22003| Best HMM Match : Ank (HMM E-Value=1.8e-39) Length = 304 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 510 CHRQFLRQIVNFGNNIICIHFNGRRVLAPCIALE 409 CH +R +V G ++ C+ F G V+ C +L+ Sbjct: 216 CHNDAVRLLVECGASVDCLDFTGFSVIRRCQSLQ 249 >SB_45993| Best HMM Match : TEP1_N (HMM E-Value=0.48) Length = 369 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 328 DLVMSTVCGCKYSGSPCFATLSGACAG 248 D+VM TV GC+YS S + +L C G Sbjct: 248 DVVMRTVRGCRYSDS-AWMSLCAQCVG 273 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,085,478 Number of Sequences: 59808 Number of extensions: 502075 Number of successful extensions: 1213 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -