BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120645.seq (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr... 27 1.9 SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces ... 27 3.4 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 26 4.5 SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces ... 26 5.9 SPCC553.10 |||conserved fungal protein|Schizosaccharomyces pombe... 26 5.9 SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1 |Schizosa... 25 7.8 SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe... 25 7.8 >SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 27.5 bits (58), Expect = 1.9 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 332 LNHARFGNEHCVWVQIQRVALLCHAIGAWCWIWSACSNVDLYLPSTW 192 L+ + FG +W + R L C G WI C V L + S W Sbjct: 123 LSRSSFGTWGSLWPILNRSVLACVWYGVQAWIGGEC--VVLMIRSIW 167 >SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1147 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 454 DVIAKIDDLTQKLTVANA 507 D +KID LT+KL VANA Sbjct: 618 DSASKIDSLTEKLKVANA 635 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 583 SRFSVASSHNHFVGKQNERSVASAK 509 S FS + SHNH Q E+S +++K Sbjct: 537 SPFSKSKSHNHHPSSQVEKSTSNSK 561 >SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 623 VRRFRGARFRNLAEPFQRRVEPQSF 549 VRR+R R L PF+R +P+ F Sbjct: 222 VRRYRDGSGRQLFAPFERLPDPRMF 246 >SPCC553.10 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 349 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 Query: 191 STSTASTNRRLSMPTKSSTMLR*RGKAGRPAVFAPTHSAHYQI 319 S+S++ ++ R S T S + + RP VF T +HY I Sbjct: 162 SSSSSKSSSRSSSRTTSHRTTSHKSSSYRPTVFPYTTISHYNI 204 >SPAC22F3.10c |gcs1|apd1|glutamate-cysteine ligase Gcs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 669 Score = 25.4 bits (53), Expect = 7.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 109 GDEQPVRFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHAD 234 GDE V+ D S V+ + ++ GKY+ TF H D Sbjct: 48 GDEIECIVVSMDDKSKKARVSLRQEDILNALGKYEETFRHVD 89 >SPAC17A5.15c |||glutamate-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +2 Query: 536 LFANEMIVARRDAETARQDCE 598 +FANE+++ + DA++ +QD E Sbjct: 556 IFANEILIEQADAQSFKQDEE 576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,851,153 Number of Sequences: 5004 Number of extensions: 57466 Number of successful extensions: 163 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -