BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120645.seq (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1588 - 28067972-28068058,28068149-28068479,28069632-28069864 30 1.5 11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802,906... 29 3.5 10_02_0110 - 5371536-5372882 29 4.6 02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222,445... 29 4.6 11_01_0755 - 6343084-6345172,6345526-6346367 28 6.1 02_05_0886 + 32507324-32507938,32508103-32508252,32508498-325089... 28 6.1 >08_02_1588 - 28067972-28068058,28068149-28068479,28069632-28069864 Length = 216 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = +3 Query: 468 N*RSDAKIDGGQRSLAEATDRSFCLPTK*LWLDATLKRLGKIAKTRAAKTAHWANRMAD 644 N S+ D + +L R+ C P W++ + G IA+ R+A WANR D Sbjct: 111 NLNSNPHADPAEDTLYRILSRNGCAPE---WVELNKEIRGMIARWRSALRKAWANRSED 166 >11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802, 9060606-9060720,9061781-9061907,9062915-9062990, 9064247-9064365,9065430-9065593,9065666-9065779, 9065966-9066065,9066276-9066340,9068175-9068253, 9069513-9069659,9069904-9070161,9070657-9070852, 9071179-9071402,9072531-9072554 Length = 793 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 326 HARFGNEHCVWVQIQRVALLCHA 258 H FG++H + VQ+Q A++CHA Sbjct: 203 HIVFGSQHNLPVQLQAKAVICHA 225 >10_02_0110 - 5371536-5372882 Length = 448 Score = 28.7 bits (61), Expect = 4.6 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 6/68 (8%) Frame = -1 Query: 328 ITPDLVMSTVCGCKY----SG-SPCFATLSEHGAGFGRHAQTSICTCRRRGHVLPVHNLH 164 I+PD +S + +Y +G S C+ G R Q S+CT R R H L VH Sbjct: 320 ISPDGKLSFIVTSRYFDGSAGVSSCYHLAFGSNGGCTRE-QVSVCTWRVRLHELRVHRSD 378 Query: 163 ILNC-WRC 143 +N W C Sbjct: 379 AMNLRWFC 386 >02_01_0599 - 4455151-4455915,4455999-4456098,4456176-4456222, 4456566-4456612,4457299-4457461,4458013-4458042 Length = 383 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 421 KYAPAVEMDTNDVIAKIDDLTQKLTVANAVWRK 519 ++AP+VE +V A I+ +T+K+ + W+K Sbjct: 304 RHAPSVEHSLAEVAAHIEAVTEKIIMEEEKWKK 336 >11_01_0755 - 6343084-6345172,6345526-6346367 Length = 976 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 421 KYAPAVEMDTNDVIAKIDDLTQKL-TVANAVWRKQ 522 +Y+P +E+D ++ K D L L +V N +WR++ Sbjct: 350 EYSPELELDLPSILEKCDGLPLALVSVGNFLWRER 384 >02_05_0886 + 32507324-32507938,32508103-32508252,32508498-32508935, 32509038-32509151,32509256-32509852 Length = 637 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = -1 Query: 619 AVFAARVFAIL--PSRFS--VASSHNHFVGKQNERSVASAKLRW 500 A A V A++ P++FS +A++ N+F+GK E S + +W Sbjct: 584 AALAENVGAVMSDPNKFSAAIAAAINNFMGKDGESSSGKSSSKW 627 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,009,325 Number of Sequences: 37544 Number of extensions: 431606 Number of successful extensions: 1205 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -