BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120645.seq (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 30 0.060 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 24 5.2 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 6.9 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 9.1 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 9.1 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 30.3 bits (65), Expect = 0.060 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -2 Query: 288 NTAGRPALPRYRSMVLDLVGMLKRRFVLAV 199 N A + AL RY+S V D+VG+L F+ A+ Sbjct: 2431 NEAFKKALQRYKSNVPDIVGVLNHHFMTAL 2460 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 624 SAPFSRRAFSQSCRAVSASRRATIISLANKMSDRLLPPN 508 S+P +Q + + A RR ++S A K+ RLL PN Sbjct: 17 SSPILNPEDTQKLQLLPAVRRP-LLSDAEKLEQRLLAPN 54 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 6.9 Identities = 7/23 (30%), Positives = 11/23 (47%) Frame = +1 Query: 238 IQHHAPIAWQSRATRCICTHTQC 306 + HH + Q R C C + +C Sbjct: 425 LHHHQQVHNQQRILYCFCRNVEC 447 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 689 HSCGLLGLAITFLRNVRHAVGPVR 618 H C L G +T +RN H P R Sbjct: 500 HRCKLCGKVVTHIRNHYHVHFPGR 523 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.0 bits (47), Expect = 9.1 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = -2 Query: 588 CRAVSASRRAT-IISLANKMSDRL--LPPNCVGHR-QFLRQIVNFGNNII 451 CR SR + + A+++++ L L PN G + + RQ++N GN+II Sbjct: 734 CRKQHHSRHLERVANKASRITNALTCLMPNKRGPKSRSRRQLINVGNSII 783 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,132 Number of Sequences: 2352 Number of extensions: 16134 Number of successful extensions: 32 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -