BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120645.seq (691 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical pr... 31 0.59 AF098993-5|AAC67468.1| 325|Caenorhabditis elegans Hypothetical ... 29 2.4 >Z22181-4|CAA80182.1| 824|Caenorhabditis elegans Hypothetical protein ZK632.5 protein. Length = 824 Score = 31.5 bits (68), Expect = 0.59 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 4/68 (5%) Frame = +1 Query: 127 RFVAKDIASSLKYVNCERAIRVHVDGKYKSTFEHADQIQHHAP-IAWQ---SRATRCICT 294 R +D +SLK V+ + + V +DG+YK ++++ P +AW + TR + Sbjct: 93 RLSDEDFENSLKEVSLSQKLMVRIDGEYKYRLYSKPIVRNNIPQLAWDISPALRTRKVAE 152 Query: 295 HTQCSLPN 318 + S PN Sbjct: 153 KDEISPPN 160 >AF098993-5|AAC67468.1| 325|Caenorhabditis elegans Hypothetical protein T10B11.6 protein. Length = 325 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 666 GYHVLAQCPPCGWPSAPFSRRAFSQS--CRAVSA 571 GY V++ CPPC S P SR F S RA+ A Sbjct: 95 GYRVVSLCPPCYHYSIPNSRVGFYMSPLFRAIDA 128 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,335,673 Number of Sequences: 27780 Number of extensions: 351268 Number of successful extensions: 878 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -