BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120644.seq (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 27 2.6 SPAC13G6.06c |||glycine cleavage complex subunit P|Schizosacchar... 25 7.8 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 8/40 (20%) Frame = +2 Query: 413 IWQNVSNFRDKCFFFS--------INTNCDLNMTPKCIKS 508 +WQ++SN+ C +NT CD N++ K KS Sbjct: 368 VWQSISNYSSACLPMGASISVKALVNTRCDKNLSEKGEKS 407 >SPAC13G6.06c |||glycine cleavage complex subunit P|Schizosaccharomyces pombe|chr 1|||Manual Length = 1017 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -1 Query: 685 LN*SFISTEKAFKYRIVYVNI*NICEHVLFVE 590 LN ++++ + Y++VY N N+C H ++ Sbjct: 847 LNANYMAKRLSSHYKLVYTNKNNLCAHEFILD 878 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,413,014 Number of Sequences: 5004 Number of extensions: 42566 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -