BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV120619.seq
(499 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 26 0.82
>AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein
protein.
Length = 596
Score = 25.8 bits (54), Expect = 0.82
Identities = 16/43 (37%), Positives = 21/43 (48%)
Frame = -1
Query: 160 GPSPSDYHESF*LDNFTKEKFTFVATYNYFKNTVKAGRYASPV 32
G +P D+ ESF +E T V +Y K T RYA P+
Sbjct: 166 GENPPDHVESFERSGLREEVMTNVRKSSYTKPT-PIQRYAIPI 207
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 335,669
Number of Sequences: 2352
Number of extensions: 4831
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 44400195
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -