BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120618.seq (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 29 3.5 06_02_0131 + 12161268-12161781,12162123-12162867,12162950-121629... 28 8.0 05_01_0281 + 2186500-2187435,2187518-2187616,2187707-2187772,218... 28 8.0 >01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962 Length = 774 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 244 EVTEHATXNSQTFHTSDSSEGTKRFRRLPSF 152 +++EH T S+ HT S+ ++ RRL SF Sbjct: 696 KISEHDTDKSRRPHTKKSATSPRKMRRLSSF 726 >06_02_0131 + 12161268-12161781,12162123-12162867,12162950-12162986, 12163083-12163216,12163298-12163625 Length = 585 Score = 27.9 bits (59), Expect = 8.0 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 6/69 (8%) Frame = -1 Query: 333 HXDAEARVTDAARVDLAHTEDPGAVHYKPPKLQNTLLLTARHSTHPTV----AKERSDFV 166 H DA + +A V T D HY L+ LL A + P + A R+ F+ Sbjct: 84 HADAARMLLEAGAVCAERTFDGDRCHYAALNLRLRRLLKAFEARPPPLPPLPAALRATFL 143 Query: 165 ACP--RLAF 145 ACP R AF Sbjct: 144 ACPANRAAF 152 >05_01_0281 + 2186500-2187435,2187518-2187616,2187707-2187772, 2187850-2188266 Length = 505 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 343 LKNGAGVSNHMWHRLKNDDGDDKPCLN 423 L G G +NH H +DD DD P L+ Sbjct: 56 LMRGGGAANHHHHDDDDDDDDDVPWLH 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,611,706 Number of Sequences: 37544 Number of extensions: 277730 Number of successful extensions: 651 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -