BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120618.seq (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g32030.1 68416.m04070 terpene synthase/cyclase family protein... 30 1.3 At4g29280.1 68417.m04186 expressed protein ; expression supporte... 30 1.7 >At3g32030.1 68416.m04070 terpene synthase/cyclase family protein contains Pfam profile: PF01397 terpene synthase family Length = 604 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +1 Query: 40 FLNDKVIYLQNSNKNKLFELSGLSLKSCRHDFVTVESQTRA 162 +L+ ++L+ S LF LSLK +HDFV V++ T++ Sbjct: 15 YLHQAPLFLKTSQS--LFPRPSLSLKPMKHDFVCVKATTKS 53 >At4g29280.1 68417.m04186 expressed protein ; expression supported by MPSS Length = 77 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 Query: 277 CMCEVYPGGVCNPSFCVXV*YRLKNGAG 360 C ++PG C+PS CV Y NG G Sbjct: 31 CTIIIHPGSPCDPSDCVQYCYAEYNGVG 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,494,106 Number of Sequences: 28952 Number of extensions: 220813 Number of successful extensions: 493 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 493 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -